Recombinant Rhizobium radiobacter Protein virB6 (virB6)

Shipped with Ice Packs
In Stock

Description

Functional Role in the Type IV Secretion System (T4SS)

VirB6 is a polytopic inner membrane protein critical for T4SS machinery assembly. Key functional insights include:

  • Complex Formation: VirB6 mediates interactions between VirB7 (lipoprotein) and VirB9 (outer membrane protein), forming structural scaffolds for the secretion channel and T-pilus .

  • T-Pilus Biogenesis: Required for polymerization of VirB2 pilin subunits into extracellular T-pili, although some VirB6 mutants uncouple pilus assembly from substrate transfer .

  • Substrate Translocation: Facilitates T-DNA and effector protein transfer into host cells, even in the absence of detectable T-pili in certain mutants .

Interaction with Host Proteins

  • Plant Retculon-like Proteins (RTNLBs): VirB2 (T-pilus subunit) interacts with RTNLB1/2/4 and AtRAB8B GTPase in Arabidopsis, enhancing transformation efficiency. Overexpression of RTNLB1 increases susceptibility to Agrobacterium-mediated transformation .

Evolutionary and Biotechnological Insights

  • Horizontal Gene Transfer: Homologs of VirB6 are found in Bartonella and other Rhizobiales, suggesting evolutionary cross-talk between plant and mammalian pathogens .

  • Enhanced Transformation: Overexpression of HspL, a chaperone stabilizing VirB proteins, improves T-DNA transfer efficiency in recalcitrant plant species .

Challenges and Future Directions

  • Structural Resolution: The full 3D structure of VirB6 remains unresolved, limiting mechanistic insights into its role in substrate transfer vs. pilus assembly .

  • Engineering Applications: Optimizing VirB6 variants for improved T-DNA delivery in non-model plant species .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
virB6; Protein VirB6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-295
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
virB6
Target Protein Sequence
MNFTIPAPFTAIHTIFDVAFTTGLDSMLETIQEAVSAPLIACVTLWIIVQGILVIRGEVD TRSGITRVITVTIVVALIVGQANYQDYVVSIFEKTVPIFVQQFSVTGLPLQTVPAQLDTI FAVTQAVFQKIASEIGPMNDQDILAFQGAQWVLYGTLWSAFGVYDAVGILTKVLLAIGPL ILVGYIFDRTRDIAAKWIGQLITIGLLLLLLNLVATIVILTEATALTLMLGVITFAGTTA AKIIGLYELDMFFLTGDALIVALPAIAGNIGGSYWSGATQSASSLYRRFAQVERG
Uniprot No.

Target Background

Protein Families
TrbL/VirB6 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium radiobacter Protein virB6 and what is its primary function?

VirB6 is an essential component of the type IV secretion machinery in Rhizobium radiobacter (Agrobacterium tumefaciens) that plays a critical role in T-pilus formation and genetic transformation of plants. Due to its predicted topology as a polytopic inner membrane protein, virB6 is proposed to form the transport pore for cell-to-cell transfer of genetic material and proteinaceous virulence factors . As part of the type IV secretion system, virB6 functions within a complex of 12 protein components (11 VirB proteins and VirD4) that span both bacterial membranes and the murein layer, creating the machinery necessary for horizontal gene transfer processes.

To study this protein, researchers often use molecular cloning techniques with specific considerations for membrane proteins, including optimization of expression conditions and detergent selection for solubilization.

How does virB6 contribute to the pathogenicity of Rhizobium radiobacter?

VirB6 contributes to pathogenicity by enabling the bacterium to transfer T-DNA from its Ti plasmid into plant cells, ultimately leading to crown gall disease in over 140 plant species . Methodologically, this can be studied through:

  • Plant transformation assays using wild-type versus virB6 deletion mutants

  • Measuring tumor formation in model plant systems (e.g., tobacco, Arabidopsis)

  • Quantifying T-DNA transfer efficiency using reporter genes

The protein mediates assembly of the T-pilus and the functional secretion machine through its effects on VirB7 and VirB9 multimerization . Research demonstrates that in the absence of virB6, bacteria show significantly reduced virulence, confirming its essential role in the pathogenicity pathway.

What protein-protein interactions does virB6 participate in?

VirB6 participates in critical protein-protein interactions that establish the type IV secretion system. Experimental approaches to detect these interactions include:

Interaction PartnerDetection MethodFunctional Significance
VirB7Non-reducing SDS-PAGE, co-immunoprecipitationFormation of VirB7 homodimers and VirB7-VirB9 heterodimers
VirB9Crosslinking studies, two-hybrid assaysAssembly of outer membrane complex
VirB5Stability assays, co-expression studiesRegulation of T-pilus assembly
VirB3Protein accumulation analysisVirB6 presence stabilizes VirB3

Research has shown that VirB6 interacts with VirB7 and VirB9 independently of other VirB proteins . To study these interactions, researchers typically employ crosslinking studies followed by co-immunoprecipitation or pull-down assays with specifically generated antibodies against VirB proteins.

How does the topology of virB6 relate to its function?

VirB6 is a polytopic inner membrane protein with multiple transmembrane domains that create a structural basis for its function as part of the transport pore. Experimental approaches to study the topology include:

  • Membrane fractionation assays to confirm localization

  • Protease accessibility studies to determine orientation

  • Fusion proteins with reporter tags at different positions

  • Site-directed mutagenesis of predicted transmembrane regions

The topology directly relates to virB6's ability to form a channel within the inner membrane through which substrates can pass. Mutations in the transmembrane domains significantly affect protein function, substrate transfer, and T-pilus formation .

What are the optimal methods for cloning and expressing recombinant virB6?

Cloning and expressing virB6 presents significant challenges due to its toxicity in conventional E. coli systems. An effective methodological approach includes:

  • Using Rhizobium radiobacter itself as both a cloning and expression host to bypass E. coli instability issues

  • Constructing expression vectors with tightly regulated promoters (e.g., IPTG-inducible systems)

  • Employing one-step Gibson assembly for constructing viral genome-encoding plasmids in vitro

  • Transforming assembled DNA products directly into R. radiobacter

This R. radiobacter-mediated approach has been shown to successfully express proteins that are unstable in E. coli systems . For virB6 specifically, plasmids like pJS964 (PvirB-virB6) have been used for expression under native promoter control, while pPC914KS+ derivatives provide an alternative expression platform .

How can mutagenesis be used to study virB6 function?

Mutagenesis studies provide critical insights into structure-function relationships of virB6. A systematic approach includes:

  • Creating insertion mutations at specific intervals (e.g., every 30 codons) using oligonucleotide-directed mutagenesis

  • Introducing site-specific mutations at conserved residues

  • Constructing deletion mutants to identify essential regions

  • Creating fusion proteins with reporter tags

A particularly effective method involves introducing in-frame insertions (e.g., PMGS or HMGS residues) at various points along virB6, as demonstrated in previous research . Mutants can then be assessed for:

  • Protein stability and expression

  • Ability to complement virB6 deletion mutants

  • Effects on VirB7/VirB9 complex formation

  • T-pilus assembly and substrate transfer capability

How does virB6 regulate the stability of other VirB proteins?

VirB6 plays a critical role in regulating the stability of other components of the type IV secretion system. Research methods to investigate this include:

  • Quantitative immunoblotting to compare protein levels in wild-type vs. virB6 deletion strains

  • Pulse-chase experiments to measure protein half-lives

  • Co-expression studies with virB6 provided in trans

Studies have demonstrated that the absence of VirB6 leads to reduced cellular levels of VirB5 and VirB3, which function as minor components or assembly factors for T-pilus formation . Interestingly, overexpression of virB6 in trans restored levels of cell-bound and T pilus-associated VirB5 to wild type but did not restore VirB3 levels, suggesting different mechanisms of stabilization .

ProteinEffect of virB6 deletionEffect of virB6 overexpression
VirB5Reduced cellular levelsRestored to wild-type levels
VirB3Reduced cellular levelsNot restored
VirB7 monomersReducedNot restored when provided in trans
VirB7-VirB9 heterodimersReducedNot restored when provided in trans
VirB7 homodimersAbolishedNot restored when provided in trans

What approaches can distinguish between virB6's roles in T-pilus formation versus substrate transfer?

Distinguishing between virB6's roles in structural assembly (T-pilus) versus functional substrate transfer requires sophisticated methodological approaches:

  • T-pilus isolation and quantification from bacterial cultures:

    • Shear pili from cell surfaces

    • Concentrate pili by ultracentrifugation

    • Analyze by immunoblotting with anti-VirB2 (major pilin) antibodies

  • Substrate transfer assays:

    • IncQ plasmid mobilization assays

    • VirE2 effector protein translocation assays

    • Plant transformation efficiency measurements

Research with virB6 insertion mutants has revealed fascinating insights: some mutants (e.g., D60.i4 and L191.i4) can translocate IncQ plasmid and VirE2 effector protein substrates in the absence of a detectable T-pilus . This suggests that T-pilus formation and substrate transfer can be uncoupled, providing evidence for separate functional domains within virB6.

How do virB6 homologs in different bacterial species compare functionally?

Comparing virB6 homologs across bacterial species provides evolutionary and functional insights. Methodological approaches include:

  • Sequence alignment and phylogenetic analysis

  • Complementation studies with heterologous proteins

  • Domain swapping experiments

  • Structural prediction and modeling

For example, research has examined TraD, a component of the transfer machinery of the IncN plasmid pKM101 with significant sequence similarity to virB6. When expressed in a virB6 deletion strain, TraD partly permitted T-pilus formation but restored neither protein levels nor bacterial virulence . This suggests that while certain functional domains may be conserved, species-specific adaptations exist.

Similar type IV secretion systems with virB6-like components exist in other pathogenic bacteria including Brucella suis, Helicobacter pylori, Legionella pneumophila, and Bordetella pertussis . Comparative analyses can reveal conserved functional domains versus species-specific adaptations.

What evolutionary insights can be gained from studying virB6 and type IV secretion systems?

Evolutionary studies of virB6 and type IV secretion systems provide insights into the development of bacterial pathogenicity. Research approaches include:

  • Genomic analyses across bacterial lineages

  • Analysis of recombination events in oncogenic plasmids

  • Comparative studies of virB operons in different Agrobacterium genomospecies

Recent research has demonstrated how recombination contributes to the evolution of oncogenic plasmids carrying virB genes . Agrobacterium species are classified into different genomospecies with numerical identifiers (e.g., genomospecies 1 = G1), with some having accepted Latin binomials . For instance, G4 corresponds to Agrobacterium radiobacter, while G8 (containing reference strain C58) corresponds to Agrobacterium fabrum .

How can researchers overcome expression toxicity and instability issues with virB6?

Working with virB6 presents significant challenges due to toxicity and instability in conventional expression systems. Effective troubleshooting approaches include:

  • Using the R. radiobacter-mediated approach for both cloning and expression:

    • Construct viral genome-encoding plasmids in vitro by one-step Gibson assembly

    • Transform assembled DNA products directly into R. radiobacter

    • This bypasses the requirement for E. coli cloning, which often leads to instability

  • Temperature modulation:

    • Growth at 20°C rather than 28°C can reduce VirB protein turnover and improve stability

    • VirB6 overproduction phenotypes (formation of higher-order VirB9 complexes) are observed at 28°C but not at 20°C

  • Promoter optimization:

    • Using native virB promoters rather than stronger promoters can reduce toxicity

    • Tightly regulated inducible systems allow controlled expression

  • Fusion strategies:

    • GST fusions have been successfully used for antibody production (e.g., pSJ6300 expressing Plac-GST-′virB6)

What controls are essential when studying virB6 function and interactions?

Rigorous controls are essential for reliable interpretation of virB6 research results:

Control TypePurposeImplementation
Genetic complementationVerify mutant phenotypesExpress wild-type virB6 in trans in deletion mutants
Expression level verificationEnsure physiological relevanceQuantitative immunoblotting compared to wild-type levels
Membrane integrationConfirm proper localizationMembrane fractionation, protease accessibility studies
Negative controlsRule out non-specific effectsEmpty vector; unrelated membrane protein expression
Temperature controlsAccount for growth effectsCompare results at different temperatures (20°C vs. 28°C)

When studying VirB7 and VirB9 complexes, non-reducing sodium dodecyl sulfate-polyacrylamide gel electrophoresis is particularly useful for preserving and detecting the disulfide linkages between these proteins .

What emerging technologies could advance our understanding of virB6 function?

Several cutting-edge technologies hold promise for deepening our understanding of virB6:

  • Cryo-electron microscopy for structural determination of the assembled type IV secretion complex

  • Single-molecule tracking to visualize virB6 during secretion events

  • CRISPR-Cas9 genome editing for precise chromosomal modifications

  • Advanced protein-protein interaction technologies:

    • Proximity labeling approaches (BioID, APEX)

    • Hydrogen-deuterium exchange mass spectrometry

    • Single-molecule FRET studies

These approaches could help resolve longstanding questions about the dynamic assembly of the secretion apparatus and the precise role of virB6 in substrate recognition and channel formation.

How might virB6 research contribute to biotechnological applications?

Understanding virB6 and the type IV secretion system has significant implications for biotechnology:

  • Improved plant transformation systems:

    • Enhanced efficiency of Agrobacterium-mediated transformation

    • Expanded host range for recalcitrant plant species

    • Development of viral vector systems for plant biotechnology

  • Targeted protein delivery systems:

    • Engineering secretion systems for specific cargo delivery

    • Development of bacterial "injectors" for therapeutic applications

  • Novel antimicrobial strategies:

    • Targeting type IV secretion components to inhibit bacterial pathogenesis

    • Development of anti-virulence compounds that don't select for resistance

  • Synthetic biology applications:

    • Engineering bacterial communication systems

    • Creating customized horizontal gene transfer tools

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.