Recombinant Rhizobium radiobacter Protein virD4 (virD4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
virD4; Protein VirD4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-688
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
virD4
Target Protein Sequence
MNSSKTSPQRMTLSIVCSLAAGFCAASCYVTFRRGFNGEAIMTFDVFAFWYETPLYLGYA STVFWRGLSVVIFTSLAVLSSQLIISLRNQKHHGTARWAEIGEMQHAGYLQRYSRIKGPI FGKTCGPLWFGSYLTNGEQPHSLVVAPTRAGKGVGIVIPTLLTFKGSVIALDVKGELFEL TSRARKASGDAVFKFSPLDSERKTHCYNPVLDIATLPPERQFTETRRLAANLITAKGKGA EGFIDGARDLFVAGILTCIERGTPTIGAVYDLFAQPGEKYKLFAQLAEESLNKEAQRIFD NMAGNDTKILTSYTSVLGDGGLNLWADPLIKAATSRSDFSVYDLRRKKTCIYLCVSPNDL EVLAPLMRLLFQQLVSILQRSLPGKDECHEVLFLLDEFKHLGKLEAIETAITTIAGYKGR FMFIIQSLSALTGTYDDAGKQNFLSNTGVQVFMATADDETPTYISKAIGEYTFKARSTSY SQASMFDHNIQISDQGAALLRPEQVRLLDDQSEIVLIKGRPPLKLRKVQYYSDRTLKRLF ERQMGSLPEPAPLMLSDYSNDQVQSHLAEIANFNEDAAPRNRTVAEDHGSVKVGADIPER VMGINGDEDQADAREIPPELGCASRIDAGSGRSTAIVGPDYCTSAKIEVRTGTACEMKLN WVQFVSGGMLRFDKVYARSQLSLYEVSV
Uniprot No.

Target Background

Gene References Into Functions
  1. Research indicates that Agrobacterium tumefaciens oncogenic suppressors inhibit the binding of T-DNA and VirE2 protein substrates to the VirD4 coupling protein. PMID: 16194240
Protein Families
VirD4/TraG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is virD4 and what is its fundamental role in bacterial systems?

virD4 is an essential component of Type IV secretion systems (T4SS) in bacteria, functioning as a coupling protein responsible for substrate recruitment. It acts as the initial protein that selects substrate molecules in the secretion process, which are subsequently delivered to the secretory machinery . virD4 belongs to a family of ATPases that provide the driving force for the T4SS apparatus to function properly. This protein spans the bacterial inner membrane and extends into the cytoplasm, forming a crucial interface between substrate selection and the secretion channel .

In bacterial systems, virD4 plays a pivotal role in mediating horizontal gene transfer and is essential for the evolution of pathogens through the dissemination of genetic material, including antibiotic resistance and virulence genes . The protein is particularly important in conjugation processes, where it facilitates the transfer of DNA between bacterial cells.

How does the structure of virD4 relate to its function in T4SS?

The structural analysis of virD4 reveals several key features that directly correlate with its function. The protein contains a P-loop with nucleoside triphosphate hydrolase activity, which is essential for its ATPase function . This energy-generating capability drives the substrate translocation process within the T4SS machinery.

Structural modeling of virD4 from Salmonella enterica has revealed that the protein forms a hexameric ring-like structure with a central channel . This organization creates a pathway through which substrates can be processed and transferred. The protein structure includes:

  • N-terminal transmembrane domain (approximately residues 1-106)

  • Cytoplasmic domain containing the ATPase activity

  • Several insertion regions compared to related proteins, which may provide functional flexibility

These insertion regions are hypothesized to play a role in the flexible movement of the hexameric unit during relaxosome processing or transfer of substrates . The presence of concave cavities within the structure likely represents substrate binding sites that facilitate the recognition and processing of DNA or protein substrates.

What experimental evidence supports virD4's role in bacterial conjugation?

Experimental studies have provided substantial evidence for virD4's role in bacterial conjugation. In research with Bartonella rattaustraliani, scientists demonstrated that a plasmid (pNH4) encoding virD4 and other T4SS components could be transferred between bacterial species . The conjugation experiments showed:

  • Transfer of the pNH4 plasmid from B. rattaustraliani to B. henselae with a recombination frequency of approximately 1×10^-2

  • The recombination frequency could be increased up to 10% by adjusting the donor-to-recipient ratio

  • PCR verification confirmed the presence of transferred genetic material in recipient bacteria

Additionally, experiments demonstrated that virD4-containing systems are essential for conjugation, as removal of the trwB gene (encoding virD4) completely abolished conjugative transfer . This confirms that virD4 is not merely accessory but required for the conjugation process.

What is the biological significance of Rhizobium radiobacter in virD4 research?

Rhizobium radiobacter (formerly known as Agrobacterium tumefaciens) is a gram-negative soil bacterium that serves as an important model organism for studying bacterial conjugation and T4SS function . This organism is particularly valuable in virD4 research for several reasons:

  • It naturally possesses a well-characterized T4SS used for DNA transfer

  • It can survive within eukaryotic hosts, including amoebae like Acanthamoeba polyphaga

  • It participates in horizontal gene transfer events with other bacteria

Research has demonstrated that R. radiobacter can acquire the pNH4 plasmid containing virD4 from B. rattaustraliani within amoeba hosts, providing evidence for inter-species gene transfer in natural environments . This ability makes it an excellent model for studying the dynamics of virD4-mediated conjugation and gene transfer across bacterial species.

Though R. radiobacter is primarily an environmental bacterium, it has occasionally been associated with opportunistic infections in humans, particularly in immunocompromised patients or those with indwelling medical devices . This clinical relevance adds another dimension to understanding virD4's role in bacterial pathogenesis.

What methodological approaches are most effective for studying virD4-substrate interactions?

Investigating virD4-substrate interactions requires sophisticated methodological approaches that can capture the dynamic nature of these molecular interactions. Based on current research, the following methods have proven effective:

Biochemical approaches:

  • Protein-protein interaction assays using purified components

  • ATP hydrolysis assays to measure virD4 activity in the presence of different substrates

  • Cross-linking studies to capture transient interactions between virD4 and its substrates

Structural approaches:

  • Cavity prediction using tools like CASTp to identify potential substrate binding sites

  • Ligand docking simulations (e.g., using CB-DOCK and 3D-ligand docking methods) to predict binding modes

  • Electron microscopy to visualize virD4 in complex with T4SS components and substrates

One particularly successful approach involves purifying the T4SS system with virD4 bound and then solving the structure by negative stain electron microscopy . This method revealed that two copies of virD4 dimers locate on both sides of the apparatus, between the VirB4 ATPases, providing crucial information about the spatial arrangement of virD4 within the complete T4SS complex .

For studying substrate specificity, researchers have used plasmid constructs containing various oriT sequences combined with conjugation efficiency assays to determine which DNA sequences are preferentially recognized by virD4 .

How can researchers express and purify recombinant virD4 for structural and functional studies?

Expressing and purifying recombinant virD4 presents several challenges due to its membrane association and complex structure. Based on published research, the following protocol has been effective:

Expression system design:

  • Clone the virD4 gene into an expression vector with an inducible promoter (e.g., araBAD promoter)

  • Add affinity tags (typically His-tag) at either the N- or C-terminus of the protein

  • Co-express with other T4SS components when studying the protein in its native complex

Expression conditions:

  • Use E. coli strains optimized for membrane protein expression

  • Induce expression at lower temperatures (16-20°C) to improve protein folding

  • Include appropriate antibiotics for plasmid maintenance

Purification strategy:

  • Harvest cells and disrupt cell membranes using appropriate buffer systems

  • Solubilize membrane fractions using mild detergents

  • Perform affinity chromatography using the engineered affinity tag

  • Consider further purification using size exclusion chromatography

For functional studies, researchers have successfully used a combinatorial plasmid approach, where compatible plasmids encoding different components of the T4SS system are co-transformed into bacteria . This approach allows for the systematic analysis of virD4's interactions with other T4SS components.

For structural studies, researchers have employed homology modeling approaches when direct structural determination proves challenging. This involves using related structures as templates (such as PDB:1E9R) and refining the models based on sequence alignment and secondary structure prediction .

What experimental models are most suitable for studying virD4-mediated conjugation in vivo?

Several experimental models have proven valuable for studying virD4-mediated conjugation in living systems:

Bacterial conjugation assays:

  • Direct bacterial mating experiments using donor strains expressing virD4 and recipient strains with selectable markers

  • Quantification of conjugation frequency using antibiotic resistance markers

  • PCR verification of gene transfer using primers specific to transferred genetic elements

Amoeba co-culture model:
The amoeba co-culture model has emerged as a particularly valuable system for studying conjugation in a more natural context. This approach involves:

  • Co-cultivating donor and recipient bacterial strains within amoebae such as Acanthamoeba polyphaga

  • Using gentamicin killing assay to eliminate extracellular bacteria

  • Incubating the amoebae to allow intracellular bacterial conjugation

  • Lysing amoebae and recovering bacteria for analysis

This model has successfully demonstrated conjugative transfer between different bacterial species, including from B. rattaustraliani to R. radiobacter . The advantage of this system is that it mimics natural environments where bacteria may encounter each other within eukaryotic hosts.

Cell culture models:
For studying virD4's role in pathogenic processes, researchers can use mammalian cell culture models to examine:

  • Translocation of effector proteins into host cells

  • Effects of virD4 mutations on bacterial virulence

  • Intracellular survival and replication of bacteria

When selecting an experimental model, researchers should consider the specific aspect of virD4 function they wish to study, as different models highlight different aspects of T4SS activity.

How does the ATPase activity of virD4 mechanistically drive the T4SS secretion process?

The ATPase activity of virD4 plays a central role in driving the T4SS secretion process through several mechanistic steps:

Energy generation:
virD4 contains a P-loop nucleoside triphosphate hydrolase domain that hydrolyzes ATP to generate energy . This energy is harnessed to drive conformational changes within the protein and the broader T4SS complex.

Substrate recognition and processing:

  • Cavity analysis of the virD4 structure reveals specific binding pockets for substrates

  • ATP binding and hydrolysis likely induce conformational changes that modulate the affinity for substrates

  • These energy-dependent conformational changes may help unfold or process substrates prior to translocation

Hexameric dynamics:
The virD4 protein forms a hexameric ring structure with a central channel . The ATPase activity likely induces coordinated movements within this hexamer that:

  • Open and close substrate binding pockets

  • Create a peristaltic-like movement to propel substrates through the channel

  • Coordinate with other T4SS components to ensure directional transfer

Integration with T4SS machinery:
Structural studies have shown that virD4 dimers position between VirB4 ATPases within the T4SS complex . This arrangement suggests that the ATPase activities of these components are coordinated, with virD4 initiating the process by recognizing and recruiting substrates before handing them off to the secretion channel.

Mutations in the ATPase domain of virD4 have been shown to abolish conjugation, confirming the essential nature of this activity for T4SS function .

What are the implications of virD4's structural insertions on protein function and evolution?

Structural analysis of virD4 has revealed several insertion regions that distinguish it from related proteins. These insertions have significant implications for both function and evolution:

Functional implications:
Homology modeling of virD4 from S. enterica compared to the template structure (PDB:1E9R) identified several insertion regions ranging from 4-15 residues in length . These insertions are proposed to serve specific functions:

  • Providing flexibility to the hexameric structure during substrate processing

  • Creating unique binding surfaces for specific substrates

  • Facilitating interactions with other T4SS components

  • Allowing adaptability to different cellular environments

One significant insertion occupies the connecting loop at the bottom of the hexamer, while another forms a donut-like structure at the top of the core structure . These strategically positioned insertions may create unique microenvironments for substrate recognition and processing.

Evolutionary implications:
The presence of these insertions suggests evolutionary adaptations of virD4 to specific functional requirements:

  • The variability in these regions across different bacterial species may reflect adaptation to different substrate preferences

  • Conservation of key functional domains alongside variable insertion regions indicates selective pressure maintaining core functions while allowing specialization

  • The ability of virD4 to recognize diverse substrates likely contributed to the success of horizontal gene transfer in bacterial evolution

Research has shown that lateral gene transfer (LGT) involving virD4-containing systems has played a significant role in bacterial adaptation and evolution . The structural features of virD4 that enable recognition of diverse substrates would have facilitated this genetic exchange, contributing to bacterial adaptability in different environmental niches.

How can virD4 be targeted for antimicrobial development?

Given virD4's essential role in bacterial conjugation and pathogenesis, it represents a promising target for antimicrobial development. Research approaches in this area include:

Inhibitor design strategies:

  • Structure-based design of small molecules that bind to the ATPase active site

  • Peptide inhibitors that disrupt virD4 interactions with other T4SS components

  • Compounds that prevent hexamer formation or stabilize inactive conformations

Potential advantages of targeting virD4:

  • Inhibition would block horizontal transfer of antibiotic resistance genes

  • virD4 is essential for virulence in several pathogens, making it a potential anti-virulence target

  • The protein is not present in human cells, reducing potential for off-target effects

Experimental approaches for inhibitor screening:

  • ATP hydrolysis assays to identify compounds that inhibit enzymatic activity

  • Bacterial conjugation assays to measure effects on gene transfer

  • Cell culture infection models to assess impact on bacterial virulence

While targeting virD4 shows promise, researchers must consider potential challenges such as the development of resistance mechanisms and the need for inhibitors that can penetrate bacterial membranes to reach their target.

What technical challenges exist in expressing functional recombinant virD4 protein?

Researchers face several technical challenges when working with recombinant virD4 protein:

Membrane association:
virD4 contains transmembrane domains that anchor it to the bacterial inner membrane . This creates challenges for:

  • Protein solubility during expression and purification

  • Maintaining native conformation when removed from the membrane environment

  • Selecting appropriate detergents that preserve structure and function

Protein stability:

  • The large size and complex structure of virD4 can lead to folding issues

  • The ATPase domain may be susceptible to aggregation when expressed separately

  • Hexameric assembly may be difficult to achieve or maintain during purification

Expression system limitations:

  • Toxic effects on host cells when overexpressed

  • Codon usage differences between source organism and expression host

  • Need for co-expression with partner proteins for proper folding and function

Solution strategies:

  • Use of specialized expression strains designed for membrane proteins

  • Fusion tags that enhance solubility (e.g., MBP, SUMO)

  • Expression of truncated constructs containing key functional domains

  • Co-expression with chaperones or binding partners

  • Reconstitution into nanodiscs or liposomes to provide a membrane-like environment

For structural studies, researchers have successfully employed homology modeling using related proteins as templates when direct structural determination proves challenging . This approach, combined with computational analysis of predicted binding sites and function, can provide valuable insights when working with recombinant virD4 proves difficult.

How do environmental conditions influence virD4-mediated conjugation efficiency?

The efficiency of virD4-mediated conjugation can be significantly affected by environmental conditions, an area of ongoing research with important implications for understanding bacterial evolution and designing experimental systems:

Key environmental factors:

Environmental FactorEffect on ConjugationResearch Approaches
TemperatureAffects protein folding and membrane fluidityControlled temperature conjugation assays comparing efficiency across temperature ranges
pHInfluences protein conformation and ATP hydrolysis ratespH-controlled medium for conjugation experiments
Nutrient availabilityImpacts energy status and expression of conjugation machineryConjugation assays in minimal vs. rich media
Cell densityHigher density typically increases conjugation opportunitiesVarying donor:recipient ratios with quantification of transfer frequency
Host environmentProvides protected niche for conjugationAmoeba co-culture models

Research findings:
Studies have shown that the donor:recipient ratio can significantly impact conjugation efficiency, with increases of up to 10-fold when optimized . Additionally, the protected environment within eukaryotic hosts such as amoebae provides a favorable setting for conjugation, potentially sheltering bacteria from external stressors .

Future research directions:

  • Investigating how biofilm formation influences conjugation efficiency

  • Examining the impact of antimicrobial stress on transfer rates of resistance genes

  • Studying temporal dynamics of conjugation under changing environmental conditions

Understanding these environmental influences is crucial for designing effective experimental systems and interpreting results in the context of natural bacterial communities.

What is the role of virD4 in inter-kingdom DNA transfer?

virD4's role extends beyond bacterial conjugation to include inter-kingdom DNA transfer, particularly in plant-associated bacteria:

T4SS-mediated plant transformation:
Rhizobium radiobacter (formerly Agrobacterium tumefaciens) is renowned for its ability to transform plant cells by transferring T-DNA from its Ti plasmid . In this process, virD4 plays a crucial role in substrate recognition and processing prior to transfer.

Evolutionary significance:
Research has revealed unexpected evolutionary relationships between the T4SS components of mammalian pathogens like Bartonella species and plant-associated bacteria like Rhizobiales . This suggests ancient origins for these transfer systems and potential cross-kingdom gene exchange events.

Experimental evidence:
Studies have demonstrated that bacteria that parasitize different kingdoms can exchange genetic material. For example, genes encoding T4SS components in B. rattaustraliani showed close relatedness to those in Rhizobiales, suggesting gene exchange between intracellular bacteria from mammals and plants .

The discovery that B. rattaustraliani and R. radiobacter can both survive within the amoeba Acanthamoeba polyphaga and conjugate together provides a mechanism for this exchange . This finding supports the hypothesis that amoebae may serve as "melting pots" where bacteria from different ecological niches can meet and exchange genetic material.

Research applications:
Understanding virD4's role in inter-kingdom transfer has applications in:

  • Agricultural biotechnology for plant transformation

  • Evolutionary biology for tracing genetic exchange across kingdoms

  • Ecological studies of microbial communities

Future research in this area may reveal additional roles for virD4 in facilitating genetic exchange between diverse organisms, potentially expanding our understanding of horizontal gene transfer's impact on evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.