Recombinant Rhizobium radiobacter Putative K (+)-stimulated pyrophosphate-energized sodium pump (hppA)

Shipped with Ice Packs
In Stock

Description

Enzymatic Mechanism

HppA belongs to the inorganic pyrophosphatase family (EC 3.6.1.1) and functions as a K⁺-stimulated sodium pump. Unlike ATP-driven P-type ATPases , it uses pyrophosphate (PPᵢ) hydrolysis to energize sodium translocation:

PPi+H2O2Pi(ΔG drives Na+ transport)\text{PP}_i + \text{H}_2\text{O} \rightarrow 2\text{P}_i \quad (\Delta G \text{ drives Na}^+ \text{ transport})

This pump is integral to bacterial ion homeostasis, generating sodium gradients critical for nutrient uptake or stress resistance .

Subcellular Localization and Functional Insights

Fluorescence studies using eYFP-tagged HppA revealed:

  • Membrane association: Predominantly localizes to the cytoplasmic membrane .

  • Polar foci: Forms discrete clusters near cell poles, suggesting specialized microdomains for ion transport .

  • Functional conservation: Homologs in Rhodopseudomonas palustris and Thermotoga maritima share similar K⁺-stimulated sodium-pumping activity .

Microbial Energetics

HppA provides a model for studying PPᵢ-driven ion transport, a pathway less energy-intensive than ATP-dependent systems .

Symbiotic and Pathogenic Roles

Rhizobium radiobacter engages in plant symbiosis and opportunistic human infections . While HppA’s direct role in these interactions remains uncharacterized, sodium gradients may influence:

  • Biofilm formation: Critical for environmental persistence .

  • Host colonization: Ion balance affects metabolite exchange during plant-microbe interactions .

Comparative Analysis with Eukaryotic Pumps

FeatureHppA (Prokaryotic)Na⁺/K⁺-ATPase (Eukaryotic)
Energy SourcePyrophosphate (PPᵢ)ATP
Ion SpecificityNa⁺ (K⁺-stimulated)3 Na⁺ out, 2 K⁺ in per cycle
Structural ClassMembrane-bound pyrophosphataseP-type ATPase
Physiological RoleBacterial ion homeostasisCellular excitability, osmotic balance

Future Directions

  • Structural studies: Cryo-EM or crystallography to resolve conformational changes during PPᵢ hydrolysis .

  • Biotechnological engineering: Leveraging PPᵢ-driven pumps for synthetic biology applications in ion sensing or bioenergy .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
hppA; vppA; Putative K(+-stimulated pyrophosphate-energized sodium pump; Membrane-bound sodium-translocating pyrophosphatase; Pyrophosphate-energized inorganic pyrophosphatase; Na(+-PPase; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter)
Target Names
hppA
Target Protein Sequence
AGGIAEMAELGPEVRKTTDKLDSVGNTTAAIAKGFAIGSAALTALALFTAFAEEIAKNPK LTGLLVDGHLVVNLTEPGVIIGIFLGATLPFLVCAFTMEAVGKAAFEMIEEVRRQFREIP GIMEGTGRPDYAKCVDISTKAAIREMMLPGVFAVGAPLIVGFLLGAKALAGFLAGVTASG VLLAIFSPS
Uniprot No.

Target Background

Function
This is a sodium pump that utilizes the energy derived from pyrophosphate hydrolysis to drive the movement of Na+ ions across the membrane.
Protein Families
H(+)-translocating pyrophosphatase (TC 3.A.10) family, K(+)-stimulated subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Rhizobium radiobacter Putative K(+)-stimulated pyrophosphate-energized sodium pump (hppA)?

The Putative K(+)-stimulated pyrophosphate-energized sodium pump (hppA, also known as vppA) is a membrane-bound sodium-translocating pyrophosphatase found in Rhizobium radiobacter (also called Agrobacterium tumefaciens or Agrobacterium radiobacter). It functions as a primary ion pump that couples the transport of sodium ions across membranes to the hydrolysis of pyrophosphate. The enzyme has an EC number of 3.6.1.1, classifying it as a pyrophosphate-energized inorganic pyrophosphatase . The protein contains 189 amino acids in its full-length form and has a sequence that includes multiple transmembrane domains forming a channel structure essential for ion transport .

How do membrane-bound pyrophosphatases (M-PPases) differ from other ion pumps?

M-PPases such as hppA represent a unique class of primary ion pumps distinguished by their energy source and transport mechanism. Unlike the widely studied ATP-dependent pumps (like Na+/K+-ATPase), M-PPases utilize the energy from pyrophosphate hydrolysis to drive ion transport. These enzymes function as homodimeric structures that couple Na+ and/or H+ transport across membranes to pyrophosphate hydrolysis .

The K+-dependent Na+-PPases specifically require potassium for activation, while K+-independent variants can function without this cofactor. This fundamental difference relates to specific residues in helices 12, 13, and exit channel loops that affect ion selectivity and K+ activation through complex subunit-subunit communications . Recent structural studies suggest functional and structural asymmetry is a unifying principle for catalysis in these membrane proteins, with half-of-the-sites reactivity being an intrinsic property of their mechanism .

What are the optimal storage and handling conditions for recombinant hppA?

Recombinant hppA protein should be stored at -20°C for regular use, while extended storage is recommended at -20°C or -80°C. The protein is typically maintained in a Tris-based buffer containing 50% glycerol, which has been optimized for this specific protein's stability . It is important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein denaturation and loss of activity. For routine experimental work, it is advisable to prepare working aliquots that can be stored at 4°C for up to one week .

When handling the protein, researchers should maintain sterile conditions and use appropriate buffers for experimental procedures. Contamination should be carefully avoided, particularly since environmental organisms like Rhizobium radiobacter can cause pseudo-outbreaks in laboratory settings, as documented in clinical microbiology settings .

What expression systems are commonly used for producing recombinant membrane proteins like hppA?

While the search results don't specifically detail expression systems for hppA, standard approaches for membrane protein expression can be applied. These typically include:

Expression SystemAdvantagesLimitations
E. coliHigh yield, cost-effective, rapid growthPotential misfolding of complex membrane proteins
Yeast (P. pastoris)Post-translational modifications, membrane integrationLonger expression time, complex media requirements
Insect cellsSuperior folding, post-translational modificationsHigher cost, technical complexity
Mammalian cellsNative-like membrane environmentHighest cost, lowest yield, technical expertise required

For functional studies of membrane-bound pyrophosphatases, researchers often need to reconstitute the purified protein into artificial membrane systems (liposomes or nanodiscs) to evaluate transport activity. This step is crucial for verifying that the recombinant protein maintains its native conformation and functionality .

How can researchers validate the activity of recombinant hppA in vitro?

Validation of hppA activity requires assessing both its pyrophosphatase enzymatic activity and its ion transport capabilities:

  • Pyrophosphatase activity measurement: This can be quantified by measuring inorganic phosphate release from pyrophosphate using colorimetric assays (malachite green assay) or coupled enzyme assays.

  • Ion transport assessment: Techniques such as electrometric studies can demonstrate pumping activities. As seen in comparable sodium pump research, these methods can establish the sequence of pumping-before-hydrolysis mechanisms .

  • K+ dependency validation: For K+-dependent Na+-PPases like hppA, activity measurements in the presence and absence of potassium ions can confirm the stimulatory effect of K+ on enzymatic function.

Recent methodological advances for membrane-bound pyrophosphatases include time-resolved structural studies that capture different states of the transport cycle, providing insights into the conformational changes associated with ion pumping and substrate binding .

What is the proposed mechanism for ion selectivity in membrane-bound pyrophosphatases?

The ion selectivity mechanism in membrane-bound pyrophosphatases involves a complex interplay of specific residues, particularly in helices 12, 13, and the exit channel loops. Recent structural studies have revealed key insights into this process:

  • Subunit-subunit communication plays a critical role in determining ion selectivity, with specific residues forming networks that control which ions (Na+ or H+) can be transported.

  • For K+-dependent Na+-PPases like hppA, potassium acts as an allosteric activator, binding to specific sites that trigger conformational changes necessary for efficient coupling of pyrophosphate hydrolysis to sodium transport.

  • Asymmetric substrate binding occurs in a time-dependent manner, supporting the concept of half-of-the-sites reactivity where only one subunit of the homodimer is catalytically active at any given time .

These findings have led to a unified model for ion-pumping, hydrolysis, and energy coupling applicable to all M-PPases, including those with dual specificity that can pump both Na+ and H+ .

How does the sodium pump contribute to neuronal excitability in comparison to hppA function?

While hppA and neuronal sodium pumps (Na+/K+-ATPase) use different energy sources (pyrophosphate vs. ATP), they share functional similarities in establishing ion gradients. In pyramidal neurons, the sodium-potassium ATPase generates long-lasting afterhyperpolarizations (AHPs) following action potential trains, lasting approximately 20 seconds . These AHPs are:

  • Insensitive to voltage-gated calcium channel blockade or intracellular calcium chelation

  • Blocked by tetrodotoxin, ouabain, or extracellular potassium removal

  • Correlated with the decay of activity-induced increases in intracellular sodium

This neuronal sodium pump activity provides intrinsic, activity-dependent regulation of excitability, with the hyperpolarizing pump current generated by the asymmetric exchange of three intracellular sodium ions for two extracellular potassium ions . The fundamental electrogenic principle of creating ion gradients across membranes is conceptually similar between neuronal Na+/K+-ATPase and bacterial hppA, despite their differences in structure, energy source, and evolutionary origin.

What structural features enable the coupling of pyrophosphate hydrolysis to ion transport?

The coupling mechanism between pyrophosphate hydrolysis and ion transport in M-PPases involves several structural features revealed through recent crystallographic and time-resolved structural studies:

  • Catalytic site architecture: The pyrophosphate binding pocket contains conserved residues that coordinate the substrate and catalyze its hydrolysis, with conformational changes transmitted to the ion transport channel.

  • Ion binding sites: Specific residues form coordination spheres for the transported ions (Na+ or H+), with selectivity determined by the precise arrangement of these sites.

  • Coupling mechanism: Recent findings suggest a "pumping-before-hydrolysis" sequence wherein ion binding and translocation precede the actual hydrolysis of pyrophosphate, as demonstrated through electrometric studies .

  • Structural asymmetry: Despite being homodimers, M-PPases display functional asymmetry with time-dependent substrate binding. This asymmetry appears to be a fundamental principle underlying the catalytic cycle and may explain the half-of-the-sites reactivity observed in these enzymes .

The structural basis for K+ dependency in enzymes like hppA involves additional regulatory sites where potassium binding induces conformational changes that optimize the coupling between hydrolysis and transport.

How do pyrophosphate-energized sodium pumps differ across bacterial species?

Pyrophosphate-energized sodium pumps show considerable diversity across bacterial species, as exemplified by the differences between the Rhizobium radiobacter hppA and its homolog in Bacteroides thetaiotaomicron:

FeatureR. radiobacter hppAB. thetaiotaomicron homologFunctional Implication
Sequence length189 amino acids 734 amino acids Potential differences in domain architecture
K+ dependencyK+-stimulatedMay have different K+ requirementsDifferent regulatory mechanisms
Ion specificityNa+ transportMay transport Na+ and/or H+Adaptation to different ecological niches

These differences reflect evolutionary adaptations to specific environmental conditions and metabolic requirements. Some M-PPases are K+-dependent, requiring potassium for activation, while others are K+-independent. Additionally, ion specificity varies, with some pumps transporting exclusively Na+, others exclusively H+, and some capable of transporting both ions .

What is the ecological significance of Rhizobium radiobacter in research and clinical settings?

Rhizobium radiobacter (formerly Agrobacterium tumefaciens/Agrobacterium radiobacter) is primarily an environmental organism with significant agricultural importance due to its ability to genetically transform plants. In research settings, it serves as a model organism for studying bacterial-plant interactions and horizontal gene transfer.

In clinical contexts, R. radiobacter is infrequently associated with human disease but has been implicated in pseudo-outbreaks and occasional opportunistic infections. A documented pseudo-outbreak linked R. radiobacter to contaminated laboratory tissue processing using non-sterile saline . Risk factors for opportunistic infections include:

  • Presence of intravenous catheters or medical devices

  • Neutropenia

  • Hematologic or solid organ malignancy

Understanding the properties of organisms like R. radiobacter and their membrane transport proteins such as hppA provides insights into bacterial physiology and potential virulence factors, although hppA itself has not been directly implicated in pathogenicity.

What are the potential biotechnological applications of recombinant hppA and related membrane-bound pyrophosphatases?

Membrane-bound pyrophosphatases like hppA have several potential biotechnological applications that researchers are beginning to explore:

  • Bioenergetic engineering: M-PPases could be introduced into organisms to provide alternative energy coupling mechanisms, potentially improving stress tolerance or growth in energy-limited conditions.

  • Drug target development: As M-PPases play roles in the virulence of protist pathogens like Plasmodium falciparum (malaria), structural and functional studies of these proteins could inform the development of novel antiparasitic compounds .

  • Biosensor development: The ion-transporting properties of these proteins could be harnessed to create biological sensors for monitoring ion concentrations or pyrophosphate levels.

  • Model systems for transport mechanisms: The "pumping-before-hydrolysis" mechanism observed in M-PPases represents a distinct paradigm for energy coupling that could inform the design of artificial transport systems.

Future research will likely focus on detailed characterization of the structure-function relationships in these proteins and exploration of their potential applications in various biotechnological contexts.

What technical challenges remain in structural studies of membrane-bound pyrophosphatases?

Despite recent advances, several technical challenges persist in the structural characterization of membrane-bound pyrophosphatases:

  • Protein expression and purification: Obtaining sufficient quantities of properly folded membrane proteins remains challenging, often requiring extensive optimization of expression systems and purification protocols.

  • Crystallization difficulties: Membrane proteins are notoriously difficult to crystallize due to their hydrophobic surfaces and requirement for detergents or lipid environments.

  • Capturing transient states: The catalytic cycle involves short-lived intermediate states that are difficult to trap for structural analysis, though time-resolved structural studies have begun to address this challenge .

  • Functional reconstitution: Verifying that purified and reconstituted proteins maintain their native transport properties requires sophisticated biophysical techniques.

  • Correlation of structure with function: Connecting structural observations to functional mechanisms requires complementary approaches, including electrometric studies, mutational analyses, and computational modeling .

Addressing these challenges will require continued development of advanced methodologies for membrane protein structural biology, including cryo-electron microscopy, time-resolved crystallography, and integrative structural approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.