Recombinant Rhizobium sp. Apolipoprotein N-acyltransferase (lnt)

Shipped with Ice Packs
In Stock

Description

Functional Role in Lipoprotein Biosynthesis

Lnt is essential for triacylation of lipoproteins, a process critical for membrane anchoring and host interaction in symbiotic bacteria:

  • Mechanism: Transfers a third acyl chain to diacylated lipoproteins, enabling integration into the outer membrane .

  • Symbiotic Relevance: In Bradyrhizobium, lipid A modifications involving acyltransferases like LpxXL (a homolog) enhance stress resistance and nitrogen-fixing symbiosis with legumes . Mutants lacking acyltransferase activity show impaired nodulation and bacteroid differentiation .

  • Non-Essentiality in Some Species: Unlike E. coli, Lnt is dispensable in Helicobacter pylori and Francisella tularensis, suggesting species-specific roles in lipoprotein trafficking .

3.1. Enzymatic Studies

  • Structural Dynamics: Crystal structures of E. coli Lnt reveal open/closed conformations, informing catalytic mechanisms .

  • Mutational Analysis: Studies on Rhizobium Lnt homologs (e.g., BRADO0045) explore substrate specificity and roles in lipid A modification .

3.2. Biotechnological Uses

  • ELISA Kits: Commercial recombinant Lnt (e.g., CSB-CF502373RKX) serves as an antigen for antibody development .

  • Stress Response Models: Used to dissect how lipid modifications affect bacterial resilience to osmotic stress and antimicrobial peptides .

Comparative Analysis with Other Acyltransferases

FeatureRhizobium sp. Lnt E. coli Lnt Vibrio Lnt
Amino Acid Length534505505
Active Site MotifConserved cysteine (Cys)Cys-His-Glu triadCys-His-Glu triad
Role in VirulenceSymbiosis efficiency Essential for OM integrity Stress adaptation

Challenges and Future Directions

  • Functional Redundancy: Some rhizobia retain alternative acyltransferases (e.g., ActA) that compensate for Lnt loss .

  • Therapeutic Potential: Targeting Lnt in pathogens like H. pylori could disrupt host colonization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type will be determined during production. If you require a particular tag, please specify this at the time of order, and we will prioritize its development.
Synonyms
lnt; NGR_c00460; Apolipoprotein N-acyltransferase; ALP N-acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-531
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
lnt
Target Protein Sequence
MERLAGKIILLSGASRAFVGFLAGLLAMFAQPPFGIFAAAFISFPMLVWLIDGVATHPDE GVVRRLLPAASIGWSFGFGYFLGGLWWLGNAFLVEADLFAWAMPLAVVGLPAVLALFYAL AVLVARCLWSDGVGRIAALAVGFGVAEWLRSFLFTGFPWNAIGYAAMPMPLMMQSASVLN VATINMLAVFVFAAPALIGTGKGARVGLAVAAALFAAHIGYGYYRLSLPPPQPLTPERTV RLVQPVIDQAKKMDDRERAVIFEEHLALTAAPPQAGGKRPDIVVWPETSIPFILTDNPDA LARIADVLQDGQILVAGAVRAEDAGTGLPPRYYNSIYVIDDRGQIVGASDKVHLVPFGEY LPFEDVLNSWGLSSIAANMPGGFSAASNRSVLTLPGGRTFYPLICYEAIFADEVDGSARL SDALLNVTNDAWFGDTPGPRQHFHQAQLRTIETGLPMIRAANTGISAIVDARGVLVVGLG YNYKGVTDAILPGKMPTMTDSMLRGRIFWFTGVFLLLVAAISRRGLNFRTN
Uniprot No.

Target Background

Function
Catalyzes the phospholipid-dependent N-acylation of the N-terminal cysteine of apolipoprotein, the final step in lipoprotein maturation.
Database Links
Protein Families
CN hydrolase family, Apolipoprotein N-acyltransferase subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Apolipoprotein N-acyltransferase (lnt) and what is its biochemical function?

Apolipoprotein N-acyltransferase (lnt), also known as ALP N-acyltransferase (EC 2.3.1.-), is an enzyme involved in the posttranslational modification of bacterial lipoproteins . In many gram-negative bacteria, lnt catalyzes the final step in lipoprotein maturation by transferring an acyl group to the N-terminal cysteine of apolipoproteins. This N-acylation process is essential for proper lipoprotein trafficking and function in many bacterial species.

The complete amino acid sequence of Rhizobium sp. lnt (UniProt C3MF13) reveals characteristic features of membrane-bound enzymes, with multiple transmembrane domains that anchor the protein in the bacterial membrane . The enzyme's membrane localization is critical for accessing both lipid substrates and protein targets during the acylation process.

How does the essentiality of lnt vary across bacterial species?

Contrary to the traditional gram-negative lipoprotein paradigm, the essentiality of lnt varies significantly across bacterial species:

Bacterial Specieslnt EssentialityConsequences of lnt Mutation
Escherichia coliEssentialConditional mutants unable to grow on glucose media
Francisella spp.Non-essentialViable mutants with diacylated rather than triacylated lipoproteins
Neisseria gonorrhoeaeNon-essentialViable mutants (F62 Δlnt::aphA1) with no growth defects under anaerobic conditions
Rhizobium/BradyrhizobiumNon-essential but criticalViable mutants with severely compromised stress resistance and symbiotic capabilities

This variation suggests that alternative lipoprotein processing pathways may exist in some bacteria, or that diacylated lipoproteins may be sufficient for certain cellular functions despite being suboptimal.

What is the relationship between lnt and very long-chain fatty acid (VLCFA) modification in Rhizobium species?

In Rhizobium and related species, lnt homologs like lpxXL are involved in modifying lipid A with very long-chain fatty acids (VLCFAs). In Bradyrhizobium ORS278, LpxXL specifically transfers C26:25OH VLCFA to lipid A . This modification is distinct from but related to the traditional role of lnt in lipoprotein processing.

The VLCFA modification of lipid A is particularly important for:

  • Membrane stability under stress conditions

  • Resistance to antimicrobial peptides

  • Efficient symbiotic interactions with leguminous plants

Interestingly, even when one VLCFA (C26:25OH) is absent in lpxXL mutants, another VLCFA (C30:29OH) remains attached to lipid A, suggesting the existence of multiple acyltransferases with different specificities .

What are the optimal conditions for expressing and purifying recombinant Rhizobium sp. lnt?

Based on commercial recombinant protein preparations, the following conditions are recommended for expressing and purifying Rhizobium sp. lnt:

ParameterOptimal Condition
Expression SystemYeast expression systems have proven effective
Purification MethodAffinity chromatography with appropriate tag (determined during production)
Target Purity>85% as assessed by SDS-PAGE
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C/-80°C for long-term storage; 4°C for working aliquots (up to one week)
Stability ConsiderationsAvoid repeated freeze-thaw cycles; shelf life of 6 months (liquid) or 12 months (lyophilized)

When planning to work with recombinant lnt, it is crucial to reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol (typically to a final concentration of 50%) for long-term storage .

How can researchers generate and validate lnt mutants in Rhizobium species?

Creating and validating lnt mutants in Rhizobium species requires a systematic approach:

Mutant Generation Strategies:

  • Gene Replacement: Using suicide vectors containing disrupted lnt genes with antibiotic resistance markers

  • Transposon Mutagenesis: Random insertion of transposons followed by screening for insertions in the lnt gene

Validation Approaches:

  • Molecular Verification:

    • PCR confirmation of the mutation

    • Sequence verification of the insertion site

    • RT-PCR or RNA-Seq to confirm absence of transcript

  • Functional Validation:

    • Complementation with wild-type lnt to restore function

    • Analysis of lipoprotein processing using reporter constructs

    • Structural analysis of lipid A to confirm changes in acylation pattern

  • Phenotypic Characterization:

    • Stress resistance tests (acid, temperature, osmotic, oxidative)

    • Plant infection assays to assess symbiotic efficiency

Researchers have successfully created lpxXL mutants (lnt homologs) in Bradyrhizobium ORS278, demonstrating the feasibility of this approach in Rhizobium species .

What methods are effective for assessing the enzymatic activity of recombinant lnt?

Several complementary approaches can be used to assess lnt enzymatic activity:

In Vitro Biochemical Assays:

  • Acyltransferase Activity Assays: Measuring the transfer of labeled fatty acids to lipoprotein substrates

  • Mass Spectrometry: Determining the exact mass and structure of lipid A or lipoproteins before and after lnt treatment

Cellular Complementation Assays:

  • E. coli Conditional Mutant Complementation: Introducing the Rhizobium lnt gene into E. coli strains where endogenous lnt is under arabinose-inducible control, then testing growth on glucose media

  • Mobility Shift Analysis: Assessing the acylation state of lipoproteins by SDS-PAGE, as demonstrated with the LpnA reporter in Francisella

Structural Approaches:

  • Lipid A Analysis: Examining changes in lipid A structure using mass spectrometry to detect the presence or absence of specific VLCFAs

  • Lipoprotein Structural Analysis: Determining the acylation state of specific lipoproteins to confirm lnt activity

These methods provide complementary information about lnt function both in vitro and in cellular contexts.

How does lnt contribute to bacterial stress resistance?

The modification of lipid A with VLCFAs by lnt homologs significantly enhances bacterial stress resistance in Rhizobium species. Analysis of acpXL and lpxXL mutants has revealed critical roles in multiple stress responses:

Stress TypeImpact of VLCFA ModificationConsequence of lnt/lpxXL Mutation
High OsmolarityMembrane stabilizationIncreased sensitivity to salt stress
Detergent ExposureEnhanced membrane integrityGreater susceptibility to membrane-disrupting agents
DesiccationProtection against water lossReduced survival during drying
Antimicrobial PeptidesReduced peptide penetrationIncreased vulnerability to host defense molecules
Temperature StressMaintenance of membrane fluidityCompromised growth at temperature extremes
Acidic pHProton impermeabilityImpaired survival in acidic environments

These protective effects are attributed to the increased hydrophobicity and rigidity that VLCFAs confer to the bacterial outer membrane, creating a more effective barrier against environmental stresses .

What is the impact of lnt/lpxXL mutation on symbiotic relationships with leguminous plants?

Mutations in lnt homologs like lpxXL have profound effects on the symbiotic capabilities of Rhizobium species with their leguminous plant hosts:

Nodulation and Plant Interaction Defects:

  • Delayed Nodulation: Plants inoculated with VLCFA mutants show significant delays in nodule formation

  • Altered Nodule Morphology: Nodules are smaller, white (instead of pink), and show disorganization of the infected zone

  • Premature Senescence: Nodules undergo early senescence, limiting the duration of effective symbiosis

Bacteroid Development Abnormalities:

  • Morphological Changes: Bacteroids (the intracellular form of rhizobia) develop abnormal shapes and sizes

  • Differentiation Defects: The bacteroid differentiation process is altered, affecting symbiotic functionality

Functional Consequences:

  • Reduced Nitrogen Fixation: Plants infected with lpxXL mutants fix nitrogen less efficiently

  • Decreased Plant Growth: The compromised symbiosis results in reduced plant growth and productivity

These findings highlight the critical role of lipid A modifications in establishing and maintaining effective plant-microbe symbioses, with significant implications for agricultural applications involving rhizobial inoculants.

How can lnt be used as a tool for studying bacterial lipoprotein trafficking?

Recombinant lnt can serve as a valuable tool for investigating lipoprotein trafficking pathways:

Reporter Systems:

Researchers can develop reporter systems using tagged lipoproteins (like the cMyc-tagged LpnA described in the literature ) to track the acylation state and cellular localization of lipoproteins in various bacterial species.

Comparative Analysis of Trafficking Systems:

The variability in lnt essentiality across bacterial species provides a natural experiment for studying alternative lipoprotein trafficking pathways. For instance, in Francisella, the LolFD machinery can recognize diacylated lipoproteins for sorting to the outer membrane, contrary to the established model in E. coli .

Structure-Function Analysis:

By creating point mutations in specific domains of lnt, researchers can investigate which regions are critical for substrate recognition, catalytic activity, and membrane association, advancing our understanding of acyltransferase mechanisms.

What are the emerging applications of lnt research in biotechnology and agriculture?

The study of lnt and related acyltransferases has several promising applications:

Improved Rhizobial Inoculants:

Understanding how lipid A modifications affect symbiotic efficiency could lead to enhanced rhizobial strains for agricultural use. Engineering strains with optimized VLCFA patterns might improve:

  • Stress tolerance in field conditions

  • Nodulation efficiency

  • Nitrogen fixation capacity

  • Persistence in soil environments

Novel Antimicrobial Targets:

The essential nature of lnt in some bacteria makes it a potential target for new antimicrobials. The structural differences between bacterial and eukaryotic acyltransferases offer opportunities for selective inhibition.

Protein Modification Technologies:

The specific acyltransferase activity of lnt could be harnessed for biotechnological applications, including:

  • Producing lipid-modified recombinant proteins with enhanced stability

  • Developing membrane-anchored enzymes for industrial processes

  • Creating improved vaccine adjuvants based on bacterial lipoprotein principles

What are common difficulties when working with recombinant lnt and how can they be resolved?

Researchers encountering problems with recombinant lnt can consider the following solutions:

ChallengePossible CausesRecommended Solutions
Low Protein YieldPoor expression, insolubility, degradationOptimize codon usage, use specialized expression hosts, lower induction temperature, add solubility tags
Loss of ActivityDenaturation, improper folding, cofactor lossOptimize buffer composition, add glycerol or reducing agents, ensure proper membrane environment
Storage InstabilityProtein aggregation, protease contaminationStore at -80°C with 50% glycerol, add protease inhibitors, avoid freeze-thaw cycles
Inconsistent ResultsBatch variation, degradationStandardize production protocols, perform quality control before experiments, prepare single-use aliquots

For optimal results, follow manufacturer recommendations for reconstitution and storage of commercial recombinant lnt preparations .

How can researchers differentiate between direct and indirect effects of lnt mutation?

Distinguishing primary effects of lnt mutation from secondary consequences requires a systematic approach:

  • Complementation Analysis: Reintroduce wild-type lnt to determine which phenotypes are directly restored

  • Structural Analysis: Directly measure changes in lipid A or lipoprotein structure to establish molecular consequences of the mutation

  • Comparative Genetics: Compare phenotypes of lnt mutants with those affecting related pathways to identify specific versus general effects

    • Example: The comparison of lpxXL and BRADO0045 mutants in Bradyrhizobium ORS278 helped distinguish their roles despite similar phenotypes

  • Time-Course Studies: Monitor the progression of phenotypic changes following lnt inactivation to identify primary (immediate) versus secondary (delayed) effects

  • Targeted Interventions: Test whether specific phenotypes can be rescued by exogenous factors without restoring lnt function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.