Recombinant Rhizobium sp. ATP synthase subunit a (atpB)

What is the structure and function of Rhizobium sp. ATP synthase subunit a (atpB)?

ATP synthase subunit a (atpB) is a crucial transmembrane component of the F0 sector of ATP synthase in Rhizobium species. The protein consists of 250 amino acids and functions as part of the proton channel that enables ATP synthesis through oxidative phosphorylation . The protein contains multiple transmembrane domains that facilitate proton movement across the membrane, contributing to the electrochemical gradient necessary for ATP production. The full amino acid sequence of Rhizobium sp. ATP synthase subunit a begins with MSNDPTHQFLVNKIVPIEIGGIDFSFTNASLFMVATVGVAAGFLYLTTSQRGVIP and continues as documented in protein databases .

How is recombinant Rhizobium sp. ATP synthase subunit a (atpB) typically expressed?

Recombinant Rhizobium sp. ATP synthase subunit a (atpB) is predominantly expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . The full-length protein (1-250 amino acids) from Sinorhizobium fredii (strain NBRC 101917/NGR234) is commonly expressed with a 10xHis tag at the N-terminus . The expression typically employs standard bacterial expression vectors and IPTG induction protocols optimized for transmembrane proteins. After expression, the protein is often isolated through affinity chromatography using the His-tag, followed by proper folding verification methods .

What are the optimal storage conditions for recombinant Rhizobium sp. ATP synthase subunit a (atpB)?

For optimal stability, recombinant Rhizobium sp. ATP synthase subunit a (atpB) should be stored at -20°C for regular use, or at -80°C for extended storage periods . The protein is typically supplied in a lyophilized form or in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . When reconstituted, it should be prepared in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added as a cryoprotectant . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided to maintain protein integrity and activity .

How does the bacterial origin of ATP synthase subunit a affect its properties?

The ATP synthase subunit a from Rhizobium species, particularly Sinorhizobium fredii, has evolved specific adaptations related to the symbiotic lifestyle of these bacteria . Unlike ATP synthases from non-symbiotic bacteria, the Rhizobium variant may contain specific amino acid sequences that contribute to its function under the unique metabolic conditions present during nitrogen fixation in root nodules . The transmembrane nature of this protein is particularly important for maintaining energy homeostasis during the bacteroid stage, where Rhizobium undergoes significant morphological and metabolic changes to facilitate nitrogen fixation .

What are the critical considerations for functional assays of recombinant Rhizobium sp. ATP synthase subunit a (atpB)?

When designing functional assays for recombinant Rhizobium sp. ATP synthase subunit a (atpB), researchers must address several critical factors. First, as a transmembrane protein, atpB requires proper lipid environments for accurate functional assessment . Reconstitution into liposomes or nanodiscs is recommended to maintain native conformation. Second, ATP synthesis activity should be measured using proton gradient-dependent assays that monitor ATP production under varying pH conditions .

The assay buffer composition is critical and typically includes:

Additionally, researchers should compare activity of the recombinant protein to positive controls and evaluate the effects of known ATP synthase inhibitors to confirm specificity of the observed activity .

How can I troubleshoot low expression yields of Rhizobium sp. ATP synthase subunit a (atpB) in E. coli systems?

Low expression yields of Rhizobium sp. ATP synthase subunit a (atpB) in E. coli are common due to its transmembrane nature . To troubleshoot this issue, consider implementing the following methodological approaches:

• Expression strain optimization: Test multiple E. coli strains specifically designed for membrane proteins (C41(DE3), C43(DE3), or Lemo21(DE3)) .

• Induction protocol modifications:

  • Reduce IPTG concentration to 0.1-0.5 mM

  • Lower induction temperature to 16-20°C

  • Extend expression time to 16-24 hours

• Codon optimization: Analyze the atpB sequence for rare codons in E. coli and consider using a codon-optimized synthetic gene or E. coli strains carrying additional tRNA genes .

• Fusion partner screening: Test expression with alternative solubility-enhancing fusion tags beyond the standard His-tag, such as MBP, SUMO, or Trx .

• Membrane protein-specific detergents: Include specific detergents in the lysis buffer to enhance extraction efficiency:

Implement these strategies systematically, testing one variable at a time and documenting results to identify optimal expression conditions .

What structural analysis techniques are most informative for studying Rhizobium sp. ATP synthase subunit a (atpB)?

For structural analysis of Rhizobium sp. ATP synthase subunit a (atpB), researchers should employ complementary techniques that address the challenges inherent to transmembrane proteins . Cryo-electron microscopy (cryo-EM) has emerged as the preferred method for high-resolution structural determination of membrane protein complexes like ATP synthase. This technique allows visualization of the protein in a near-native lipid environment without the need for crystallization .

For intermediate-resolution structural information, circular dichroism (CD) spectroscopy provides valuable data on secondary structure content, particularly the alpha-helical regions that dominate the transmembrane domains of atpB. Typical CD analysis reveals approximately 65-75% alpha-helical content in properly folded ATP synthase subunit a .

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers insights into protein dynamics and solvent accessibility, particularly useful for mapping transmembrane regions and potential conformational changes during proton translocation. For atomic-level information on specific residues, site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy can reveal distance constraints and dynamic properties of targeted regions within the protein .

These techniques should be applied in combination, as each provides complementary structural information:

How does the function of Rhizobium sp. ATP synthase subunit a (atpB) relate to nitrogen fixation in legume-rhizobia symbiosis?

The ATP synthase subunit a (atpB) plays a critical role in energy metabolism during legume-rhizobia symbiosis . During symbiotic nitrogen fixation, Rhizobium bacteria transform into bacteroids within root nodules, undergoing significant metabolic reprogramming . In this microaerobic environment, the ATP synthase complex must function efficiently to provide energy for the highly demanding nitrogen fixation process .

The atpB protein's role becomes particularly crucial due to the oxygen sensitivity of nitrogenase, the enzyme responsible for nitrogen fixation . The nodule maintains low oxygen conditions through leghaemoglobin, which provides sufficient oxygen for bacteroid respiration while protecting nitrogenase activity . In this delicate balance, ATP synthase must generate ATP using the reduced proton gradient available under microaerobic conditions .

Research suggests that specific adaptations in the atpB sequence of symbiotic rhizobia may enhance ATP synthase efficiency under these unique conditions . The transmembrane domains of atpB appear to have evolved to optimize proton translocation at the lower oxygen tensions found in root nodules . Additionally, the protein may interact with plant-derived factors that modulate its activity during the symbiotic relationship .

This functional adaptation is evidenced by comparative studies of ATP synthase activity between free-living rhizobia and bacteroids, which demonstrate altered kinetic parameters:

Understanding these adaptations provides insights into the evolution of symbiotic relationships and may inform strategies for enhancing nitrogen fixation efficiency in agricultural applications .

What considerations are important when using Rhizobium sp. ATP synthase subunit a (atpB) for immunological studies?

When employing Rhizobium sp. ATP synthase subunit a (atpB) for immunological studies, researchers must address several specific considerations to ensure valid and reproducible results . As a transmembrane protein, atpB contains both hydrophobic regions embedded in the membrane and hydrophilic regions exposed to the aqueous environment . This structural characteristic significantly impacts epitope selection for antibody production.

For antibody development, researchers should prioritize hydrophilic regions that are likely to be surface-exposed in the native protein conformation . Epitope prediction algorithms can identify candidate sequences, but these should be validated experimentally. The N-terminal His-tag present in most commercial recombinant preparations must be considered when interpreting immunological data, as it may generate non-specific signals or interfere with native epitope recognition .

When designing immunoassays using anti-atpB antibodies, denaturation conditions must be carefully optimized:

Cross-reactivity with ATP synthase proteins from other bacterial species must be experimentally determined, as the conservation of sequence and structure across bacterial ATP synthases can lead to non-specific binding . This is particularly important when studying mixed bacterial populations or when examining host tissues that may contain other bacterial species .

How can I optimize protein-protein interaction studies involving Rhizobium sp. ATP synthase subunit a (atpB)?

Protein-protein interaction studies involving Rhizobium sp. ATP synthase subunit a (atpB) require specialized approaches due to its transmembrane nature and integration within the multi-subunit ATP synthase complex . For meaningful results, interaction studies should maintain native-like membrane environments while providing sufficient sensitivity to detect specific binding partners.

The most effective methodological approach combines complementary techniques:

• Co-immunoprecipitation (Co-IP) using anti-His antibodies can capture the recombinant His-tagged atpB along with interacting partners . The protocol should be modified to include:

  • Mild solubilization with 1% digitonin or 0.5% DDM

  • Extended incubation times (4-6 hours) at 4°C

  • Low-salt washing buffers (50-100 mM NaCl)

• Proximity-based labeling approaches, particularly BioID or APEX2 fusions to atpB, allow for identification of transient or weak interactions that may be disrupted during traditional pull-down assays .

• Microscale thermophoresis (MST) provides quantitative binding parameters when testing specific protein-protein interactions, with the advantage of working with membrane proteins in detergent micelles or nanodiscs .

The choice of detergent is critical for maintaining protein interactions while achieving effective solubilization:

To validate interactions, orthogonal confirmation using at least two independent methods is strongly recommended, along with appropriate negative controls including non-related transmembrane proteins from the same organism .

What are the key factors to consider when studying the role of ATP synthase in Rhizobium during symbiotic nitrogen fixation?

When investigating ATP synthase function in Rhizobium during symbiotic nitrogen fixation, researchers must address several unique experimental challenges . Bacteroids within root nodules represent a distinct physiological state that differs significantly from free-living rhizobia, necessitating specialized experimental approaches .

First, researchers should establish appropriate experimental systems that accurately represent symbiotic conditions . These include:

• Ex planta bacteroid isolation from root nodules, which preserves the symbiotic phenotype but presents challenges for biochemical analysis due to potential contamination with plant proteins .

• Microaerobic culture systems that mimic the low oxygen tension of nodules (typically 1-2% O₂) while allowing controlled experimental manipulation .

• Plant co-culture systems using transparent growth chambers that enable real-time observation of bacteroid metabolism within nodules .

Second, energy metabolism measurements should account for the unique conditions of the symbiotic state :

Third, the integration of ATP synthesis with nitrogen fixation should be assessed by simultaneously measuring nitrogenase activity (typically via acetylene reduction assay) and ATP synthase function under varying conditions . This reveals the energetic requirements of nitrogen fixation and how ATP synthase activity is regulated to meet these demands .

How can I address the challenges of site-directed mutagenesis in Rhizobium sp. ATP synthase subunit a (atpB)?

Site-directed mutagenesis of Rhizobium sp. ATP synthase subunit a (atpB) presents significant challenges due to its transmembrane nature and essential function in energy metabolism . A systematic approach is necessary to ensure successful generation and characterization of informative mutants.

The following methodology addresses common challenges:

• Target selection: Prioritize residues based on:

  • Conserved motifs in the proton channel

  • Residues at the interface with other subunits

  • Sites identified in homologous ATP synthases

• Mutagenesis strategy: For transmembrane proteins like atpB, use overlap extension PCR with high-fidelity polymerases rather than whole-plasmid amplification, which can be inefficient with GC-rich Rhizobium DNA .

• Expression system selection: Test mutations in E. coli expression systems before transferring to Rhizobium . This allows rapid screening of multiple mutations and identifies potentially lethal mutations that would be difficult to study directly in Rhizobium.

• Complementation system: Develop a plasmid-based complementation system with inducible promoters to regulate mutant atpB expression in Rhizobium backgrounds where the chromosomal copy has been deleted or silenced .

The following table presents recommended substitution strategies for different amino acid types:

For functional characterization, implement a tiered approach:

• Expression and folding assessment via Western blotting and CD spectroscopy

• ATP synthesis activity measurement in reconstituted systems

• Proton translocation assays using pH-sensitive fluorophores

• In vivo growth complementation under different metabolic conditions

What methodologies are most effective for studying the evolution of ATP synthase genes in Rhizobium species?

Investigating the evolution of ATP synthase genes in Rhizobium species requires an integrated approach combining phylogenetic, structural, and functional analyses . Rhizobia represent an interesting case study due to their symbiotic lifestyle and adaptation to diverse host legumes, which may have driven specific evolutionary changes in their ATP synthase components .

The most effective research methodology incorporates multiple complementary approaches:

The following analytical approaches provide complementary information:

Research has shown that the BacA protein of Sinorhizobium meliloti, which is essential for establishing symbiosis with Medicago hosts, has undergone rapid evolution, with sequence similarities now closer to non-rhizobial bacteria than to other rhizobial BacA orthologs . Similar patterns may exist in ATP synthase components, particularly in regions involved in adaptation to the unique metabolic conditions of the symbiotic state .