Recombinant Rhizobium sp. Glycerol-3-phosphate acyltransferase (plsY)

What is Glycerol-3-phosphate acyltransferase (plsY) in Rhizobium sp.?

Glycerol-3-phosphate acyltransferase (plsY) in Rhizobium sp. is an essential enzyme involved in phospholipid biosynthesis, specifically catalyzing the acylation of glycerol-3-phosphate. In strain NGR234, plsY is encoded by the gene NGR_c10880 and consists of 203 amino acid residues . This enzyme belongs to the acyltransferase family and plays a crucial role in membrane lipid synthesis by transferring an acyl group from acyl-phosphate to glycerol-3-phosphate, creating lysophosphatidic acid. The process is fundamental for bacterial membrane integrity and function, which ultimately impacts the bacterium's ability to establish symbiotic relationships with host plants.

What is the structure and sequence of Rhizobium sp. plsY?

The Rhizobium sp. strain NGR234 plsY protein consists of 203 amino acids with the following sequence: MDLFSWQLGLPATLLCLAFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNK KLAAATLLLDALKGTAAAAIASLWGVEAGIAAGLAAFLGHLFPVWLSFKGGKGVATYIGV LLGLAPLMVPAFAAIWLAAAKITRYSSLSALIATAVMPIALYATGYGKVALLFALMTVIT WIKHRANIQRLLSGTESRIGEKG . Structurally, plsY is primarily membrane-associated, containing multiple transmembrane domains that anchor it to the bacterial cell membrane. The catalytic domain is positioned to interact with both the membrane-embedded substrates and cytoplasmic components. The protein's Uniprot accession number is C3MA95, providing researchers with access to additional structural information including predicted secondary structure elements and functional domains.

How does plsY function differ between Rhizobium species and other bacteria?

Rhizobium sp. plsY exhibits species-specific functional characteristics that distinguish it from homologous enzymes in other bacteria. While the core catalytic mechanism of acyl transfer remains conserved, Rhizobium plsY has evolved adaptations related to its symbiotic lifestyle. Unlike plsY in free-living bacteria, the Rhizobium variant may have altered substrate specificity and regulation patterns that optimize membrane composition for root nodule formation and nitrogen fixation processes.

The plsY enzyme in Rhizobium appears to be part of a broader signaling network involved in plant-microbe interactions, particularly in the context of systemic immunity regulation. Glycerol-3-phosphate, the substrate of plsY, functions as a mobile signal molecule in plant systemic acquired resistance (SAR) and plays a role in the exclusion of non-desirable rhizobia strains . This suggests that plsY activity may indirectly influence host-microbe compatibility through its impact on G3P metabolism, a feature not prominently observed in non-symbiotic bacteria.

What are the optimal storage and handling conditions for recombinant plsY protein?

Recombinant Rhizobium sp. plsY requires specific storage and handling conditions to maintain stability and enzymatic activity. The purified protein should be stored in a Tris-based buffer containing 50% glycerol, which prevents protein denaturation and microbial contamination . For short-term storage (up to one week), the protein can be kept at 4°C, but for extended preservation, storage at -20°C is recommended, with -80°C being optimal for long-term archiving .

It is critical to avoid repeated freeze-thaw cycles as they can significantly reduce protein activity; therefore, working aliquots should be prepared upon initial thawing . When handling the protein, researchers should maintain sterile conditions and use buffers optimized for acyltransferase activity, typically containing divalent cations such as Mg²⁺ and reducing agents to prevent oxidation of catalytic cysteine residues. Temperature control during experiments is also essential, with most enzymatic assays performed at 28-30°C to mimic the physiological conditions of Rhizobium.

What methods are most effective for studying plsY enzymatic activity in vitro?

To effectively study plsY enzymatic activity in vitro, researchers should employ a combination of spectrophotometric, radiometric, and mass spectrometry-based approaches. A standard acyltransferase assay involves monitoring the transfer of radioactively labeled acyl groups from acyl-phosphate donors to glycerol-3-phosphate, followed by thin-layer chromatography separation and quantification of labeled products.

For higher throughput analysis, a coupled enzymatic assay can be used where the release of inorganic phosphate during the acyltransferase reaction is linked to colorimetric detection systems such as malachite green. Mass spectrometry methods, particularly LC-MS/MS, provide detailed insights into substrate specificity by identifying the precise acyl chains transferred and the resulting lysophosphatidic acid products.

Enzymatic parameters (Km, Vmax, kcat) should be determined under varying conditions including pH (typically 6.5-8.0), temperature (20-40°C), and ionic strength to establish the optimal reaction environment. Additionally, potential inhibitors or activators can be identified through systematic screening with metabolites involved in phospholipid metabolism and signaling pathways relevant to plant-microbe interactions.

How can researchers effectively express and purify recombinant Rhizobium sp. plsY?

Expression and purification of recombinant Rhizobium sp. plsY presents challenges due to its membrane-associated nature. The most successful approach involves using specialized expression systems with careful consideration of construct design. The full-length protein (expression region 1-203) should be cloned into vectors containing appropriate fusion tags to aid solubility and purification .

The expression protocol typically involves:

• Cloning the plsY gene (NGR_c10880) into an expression vector with an N-terminal His-tag or MBP (maltose-binding protein) fusion to improve solubility

• Transforming the construct into E. coli expression strains optimized for membrane proteins (e.g., C41(DE3) or C43(DE3))

• Culturing at reduced temperatures (16-20°C) after induction to minimize inclusion body formation

• Cell lysis using mild detergents (e.g., n-dodecyl-β-D-maltoside or CHAPS) to solubilize membrane-associated proteins

• Purification via affinity chromatography followed by size exclusion chromatography

For structural studies, incorporating a TEV protease cleavage site between the tag and protein allows removal of the fusion partner after purification. The purified protein should be maintained in detergent micelles or reconstituted into nanodisc systems to preserve native conformation and activity.

How does plsY contribute to Rhizobium-legume symbiosis?

The plsY enzyme in Rhizobium sp. contributes to symbiotic interactions with legumes through multiple mechanisms centered on its role in membrane lipid biosynthesis and potential connections to glycerol-3-phosphate (G3P) metabolism. As a key enzyme in phospholipid synthesis, plsY influences membrane composition, which is crucial for bacteroid development within root nodules. The bacteroid membrane must accommodate specialized transport systems for nutrient exchange with the host plant while maintaining selective permeability.

Research indicates that G3P, the substrate of plsY, functions as a mobile regulator in plant systemic signaling pathways . During rhizobial colonization, the plant's ability to regulate G3P levels through plsY and related enzymes appears to play a role in determining symbiotic compatibility. G3P-mediated signaling is essential for strain-specific exclusion of non-desirable root-nodulating bacteria while simultaneously conferring foliar pathogen immunity . This dual role suggests that plsY activity may influence the specificity of symbiotic associations by modulating local and systemic G3P concentrations, thereby affecting the plant's ability to discriminate between beneficial and potentially harmful microorganisms.

What role does plsY play in G3P-mediated systemic signaling during plant-rhizobia interactions?

The plsY enzyme appears to be intricately connected to G3P-mediated systemic signaling during plant-rhizobia interactions through its involvement in G3P metabolism. Studies have revealed that G3P serves as an essential mobile signal molecule in a sophisticated root-shoot-root signaling mechanism that regulates both nodulation and systemic immunity . When plants encounter incompatible rhizobia strains, they activate a G3P-dependent signaling cascade that enables specific exclusion of these non-desirable bacteria.

Notably, while the recognition of rhizobial compatibility occurs in the root, the exclusion mechanism requires G3P biosynthesis in the shoot, followed by shoot-to-root transport of G3P molecules . This indicates a complex signaling network where plsY may function as a regulator of G3P levels by controlling its incorporation into phospholipids. By modulating available G3P pools, plsY potentially influences the strength and specificity of systemic signaling, affecting both symbiotic partner selection and the activation of broad-spectrum immunity against foliar pathogens.

How can plsY be targeted for improving nitrogen fixation efficiency in agricultural applications?

Targeting plsY for improving nitrogen fixation efficiency requires precise genetic and biochemical interventions based on understanding its role in symbiotic processes. Researchers could employ the following strategies:

• Genetic modification of plsY expression levels or activity in Rhizobium strains to optimize membrane composition for enhanced bacteroid development and function.

• Engineering plsY variants with altered substrate specificity or regulatory properties to influence G3P metabolism and signal transduction during symbiosis establishment.

• Developing compounds that modulate plsY activity without inhibiting bacterial growth, potentially enhancing the selection of beneficial strains while excluding less effective symbionts.

These approaches must consider the complex signaling network involving G3P. Since G3P is essential for strain-specific exclusion of non-desirable rhizobia , careful manipulation of plsY could potentially enhance the plant's ability to select high-performing nitrogen-fixing strains while maintaining protective immunity against pathogens. Any intervention should be designed with awareness of the root-shoot-root signaling axis, as modifying G3P metabolism in one tissue may have systemic effects on both symbiosis and immunity throughout the plant.

How is the plsY gene organized in the Rhizobium sp. genome?

The plsY gene (designated as NGR_c10880) in Rhizobium sp. strain NGR234 is situated within a complex genomic context that reflects its essential metabolic function and potential regulatory connections. The gene is located on the chromosome (>3,700 kb) rather than on either the symbiotic plasmid pNGR234a (536,165 bp) or the megaplasmid pNGR234b (>2,000 kb) . This chromosomal location is consistent with plsY's fundamental role in phospholipid biosynthesis, as genes encoding core metabolic functions are typically maintained on the chromosome for stable inheritance.

The genomic organization around plsY likely includes other genes involved in phospholipid metabolism and membrane biogenesis, forming a functional cluster that facilitates coordinated expression. The genetic context of plsY may also include regulatory elements that respond to environmental conditions relevant to symbiosis, potentially allowing for adaptive changes in membrane composition during different stages of the rhizobium-legume interaction. Understanding this genomic context provides insights into how plsY expression is regulated in response to developmental cues and environmental stimuli.

What genomic rearrangements might affect plsY function in Rhizobium species?

Rhizobium sp. strain NGR234 undergoes dynamic large-scale DNA rearrangements that could potentially impact plsY function and expression. Research has documented the occurrence of cointegrations and excisions between the three main replicons (chromosome, pNGR234a, and pNGR234b) at a frequency of approximately 10⁻³ . These rearrangements give rise to four distinct genomic architectures: three consisting of cointegrates between two replicons and one comprising a cointegrate of all three replicons .

These genomic rearrangements have significant implications for plsY function:

• If plsY is located near recombination hotspots, its expression could be altered when repositioned within different genomic contexts.

• Cointegration events may place plsY under the influence of novel regulatory elements, potentially modifying its expression patterns.

• Large-scale rearrangements could affect the copy number of plsY if duplication events occur during recombination.

• The stability of these genomic rearrangements suggests they may represent adaptive responses to environmental conditions, potentially optimizing plsY expression for specific ecological niches.

Interestingly, studies indicate that these genomic architecture changes do not significantly alter growth and symbiotic proficiency , suggesting robust regulatory mechanisms that maintain essential functions despite genomic plasticity.

How has plsY evolved across different Rhizobium species and what does this reveal about its function?

The evolutionary trajectory of plsY appears to balance conservation of catalytic function with diversification in regulatory mechanisms and substrate specificity. Species-specific variations in plsY sequence may correlate with differences in membrane lipid composition, which could influence compatibility with different host legumes. Additionally, the evolutionary history of plsY may reveal instances of horizontal gene transfer, particularly in regions involved in strain-specific functions related to symbiosis.

Analysis of selection pressures acting on different domains of plsY would likely show stronger conservation of catalytic regions versus greater diversity in regulatory domains. This pattern would be consistent with maintaining essential enzymatic function while allowing flexibility in how the enzyme responds to different symbiotic contexts and environmental challenges.

What molecular techniques are most effective for studying plsY gene function in Rhizobium sp.?

Advanced molecular techniques for studying plsY function in Rhizobium sp. combine classical genetic approaches with modern genomic tools. Vector insertion mutagenesis represents a powerful strategy, as demonstrated with Rhizobium sp. strain ORS571 . This approach involves mobilizing a limited-host-range plasmid (such as pVP2021 carrying Tn5) into Rhizobium, resulting in genomic cointegrates that can disrupt gene function .

For precise gene manipulation, researchers should consider:

• CRISPR-Cas9 gene editing for generating clean deletions or point mutations in plsY

• Conditional expression systems using inducible promoters to control plsY levels

• Fluorescent protein fusions to monitor plsY localization and expression patterns

• RNA-seq analysis to identify genes co-regulated with plsY under various conditions

• ChIP-seq to identify regulatory proteins that bind to the plsY promoter region

When targeting plsY specifically, researchers should be aware that complete loss of function may be lethal due to its essential role in membrane biosynthesis. Therefore, approaches that allow tunable or partial reduction in activity, such as CRISPRi or antisense RNA strategies, may be more informative. Additionally, complementation studies with plsY variants carrying specific mutations can help dissect the functional importance of different protein domains.

What bioinformatic approaches can help predict plsY substrate specificity and regulation?

Computational approaches offer powerful insights into plsY substrate specificity and regulation. A comprehensive bioinformatic analysis should include:

• Homology modeling of Rhizobium sp. plsY based on crystallized acyltransferases to predict three-dimensional structure

• Molecular docking simulations with various acyl-phosphate donors to predict substrate preferences

• Identification of conserved regulatory motifs in the promoter region through comparative genomics

• Transcription factor binding site prediction to identify potential regulators

• Protein-protein interaction network analysis to place plsY in its functional context

The amino acid sequence of plsY (MDLFSWQLGLPATLLCLAFGYLLGSIPFGLILTRMAGLGDVRKIGSGNIGATNVLRTGNK KLAAATLLLDALKGTAAAAIASLWGVEAGIAAGLAAFLGHLFPVWLSFKGGKGVATYIGV LLGLAPLMVPAFAAIWLAAAKITRYSSLSALIATAVMPIALYATGYGKVALLFALMTVIT WIKHRANIQRLLSGTESRIGEKG) can be analyzed using tools like TMHMM to predict transmembrane domains, ConSurf to identify evolutionarily conserved functional residues, and MetaPredPS to predict phosphorylation sites that might regulate enzyme activity .

Systems biology approaches, including metabolic flux analysis and kinetic modeling, can further illuminate how plsY activity influences broader metabolic networks, particularly in the context of symbiotic interactions where coordinated regulation of multiple pathways is essential.

How can researchers design experiments to investigate the role of plsY in G3P-mediated systemic signaling?

Designing experiments to investigate plsY's role in G3P-mediated systemic signaling requires a multifaceted approach that integrates molecular genetics, biochemistry, and plant physiology. Researchers should consider the following experimental design:

• Split-root experiments: Use a split-root system where different strains of Rhizobium (compatible vs. incompatible) are inoculated on separate roots of the same plant, allowing measurement of systemic responses and G3P transport.

• Grafting studies: Similar to those described in search result , grafting experiments between wild-type plants and those with altered plsY expression can help determine tissue-specific requirements for G3P metabolism.

• Metabolomic profiling: Quantify G3P levels and related metabolites in different plant tissues following inoculation with various Rhizobium strains, correlating these with plsY expression and activity.

• Isotope labeling: Use ¹⁴C or ¹³C labeled glycerol to trace the movement and metabolism of G3P throughout the plant during symbiotic interactions.

• Conditional expression systems: Develop Rhizobium strains with inducible plsY expression to manipulate enzyme activity at specific stages of symbiosis establishment.

These experiments should be designed to distinguish between direct effects of plsY on G3P metabolism and indirect effects on signaling pathways. Additionally, researchers should consider potential feedback mechanisms where plant-derived signals might influence bacterial plsY expression and activity, creating a bidirectional signaling loop that fine-tunes both symbiosis and immunity.

What are common challenges in studying recombinant plsY and how can they be overcome?

Working with recombinant Rhizobium sp. plsY presents several challenges due to its nature as a membrane-associated enzyme and its role in complex signaling networks. Common difficulties include:

• Protein solubility issues: plsY, being a membrane-associated protein, often forms inclusion bodies when overexpressed. This can be mitigated by using specialized solubility tags (SUMO, MBP), reducing expression temperature to 16-18°C, or employing membrane-mimetic environments like detergent micelles during purification.

• Loss of enzymatic activity: Activity loss during purification can be minimized by including glycerol (50%) in storage buffers, avoiding repeated freeze-thaw cycles, and using reducing agents to prevent oxidation of catalytic cysteine residues .

• Variable substrate availability: Natural substrate heterogeneity can complicate kinetic analyses. Researchers should synthesize or source well-defined acyl-phosphate donors to ensure reproducible results.

• Complex in vivo phenotypes: Since plsY influences both membrane composition and signaling pathways, phenotypes of mutants may be difficult to interpret. Complementation with variants carrying specific mutations can help dissect different functional aspects.

• Regulatory complexity: The enzyme may be subject to post-translational modifications or allosteric regulation. Phosphoproteomic approaches and activity assays with potential regulatory metabolites can help unravel these mechanisms.

By anticipating these challenges and implementing appropriate methodological adaptations, researchers can generate more reliable and reproducible data on plsY function and regulation.

How can researchers distinguish between direct and indirect effects of plsY on plant-microbe interactions?

Distinguishing direct and indirect effects of plsY on plant-microbe interactions requires carefully designed experimental approaches:

• Enzymatically inactive mutants: Generate plsY variants with mutations in catalytic residues that maintain protein structure but lack acyltransferase activity. This helps differentiate between catalytic activity and potential structural or scaffolding roles.

• Temporal analysis: Implement time-course experiments to establish the sequence of events following rhizobial infection, correlating changes in plsY expression/activity with G3P levels and downstream signaling events.

• Spatial resolution: Use tissue-specific promoters to express or silence plsY in different root tissues, determining where enzyme activity is required for proper symbiotic development.

• Metabolic bypass experiments: Supplement plsY-deficient strains with downstream metabolites to determine if symbiotic defects result directly from missing enzymatic products or from disrupted signaling pathways.

• Heterologous expression: Express Rhizobium plsY in non-symbiotic bacteria to identify which phenotypic effects transfer with the enzyme alone versus those requiring the broader genomic context.

Additionally, researchers should consider the complex interplay between bacterial plsY activity and plant G3P metabolism. The observation that G3P biosynthesis in the shoot affects bacterial exclusion in the root suggests a sophisticated signaling network where bacterial factors may indirectly influence plant responses through metabolic crosstalk rather than direct enzymatic action.

Comparative Properties of plsY Across Selected Rhizobium Species

This comparative analysis demonstrates conservation of basic enzyme properties across Rhizobium species while highlighting subtle variations that may reflect adaptation to different host plants or environmental niches. The chromosomal location of plsY is consistently maintained across species, underscoring its fundamental metabolic importance .

What emerging technologies could advance our understanding of plsY function in Rhizobium-legume symbiosis?

Emerging technologies that could significantly advance our understanding of plsY function in symbiotic contexts include:

• CRISPR-based techniques: Beyond gene editing, CRISPRi and CRISPRa systems allow for precise modulation of plsY expression without complete gene knockout, enabling the study of dose-dependent effects on symbiosis.

• Single-cell transcriptomics and metabolomics: These approaches could reveal heterogeneity in plsY expression and G3P metabolism among bacterial populations within nodules, potentially identifying specialized subpopulations with distinct metabolic profiles.

• Live-cell imaging with biosensors: Development of fluorescent biosensors for G3P and lysophosphatidic acid would allow real-time visualization of metabolite dynamics during symbiosis establishment.

• Synthetic biology approaches: Engineered Rhizobium strains with orthogonal plsY variants responsive to non-native inducers could enable precise temporal control of enzyme activity during symbiotic development.

• Cryo-electron microscopy: Structural determination of plsY in membrane contexts could provide insights into its interaction with lipid bilayers and potential protein partners during symbiosis.

These technologies, combined with systems biology approaches to integrate multi-omics data, could illuminate how plsY functions within the broader context of plant-microbe communication systems and reveal potential applications for enhancing symbiotic nitrogen fixation in agricultural settings.

How might research on plsY contribute to sustainable agriculture practices?

Research on Rhizobium sp. plsY has significant potential to contribute to sustainable agriculture through multiple pathways:

• Enhanced biological nitrogen fixation: Understanding how plsY influences symbiotic efficiency could lead to the development of Rhizobium strains with optimized membrane properties for superior nitrogen fixation performance, reducing dependence on chemical fertilizers.

• Improved host specificity: Knowledge of how plsY and G3P metabolism contribute to symbiotic partner selection could enable the engineering of rhizobial inoculants with enhanced colonization of specific legume crops while minimizing competition from less efficient native strains .

• Dual protection strategies: Since G3P mediates both symbiosis regulation and systemic immunity , plsY-focused interventions could potentially enhance both nitrogen fixation and broad-spectrum disease resistance simultaneously.

• Climate resilience: Understanding how plsY function adapts to environmental stressors could inform the development of rhizobial strains with improved symbiotic performance under changing climate conditions, including drought and temperature extremes.

• Extended host range: Insights into how plsY influences host-microbe compatibility might eventually allow for engineering expanded host ranges for nitrogen-fixing bacteria, potentially extending benefits beyond traditional legume crops.

By focusing research efforts on the fundamental mechanisms by which plsY influences both bacterial physiology and plant-microbe communications, researchers can develop targeted applications that enhance agricultural sustainability while minimizing ecological disruption.

How does current research on plsY integrate with broader understanding of plant-microbe communication?

Research on Rhizobium sp. plsY provides an important molecular perspective that bridges bacterial metabolism with plant signaling networks. The emerging picture places plsY at the intersection of multiple interconnected processes: membrane lipid biosynthesis, symbiotic partner selection, metabolic exchange, and systemic immunity regulation. This enzyme exemplifies how bacterial metabolic processes have been integrated into sophisticated inter-kingdom communication systems through evolution.

The discovery that G3P functions as both a metabolic substrate and a signaling molecule in plant-microbe interactions highlights the elegant repurposing of primary metabolites as information carriers. plsY's role in G3P metabolism connects it to this broader signaling network, suggesting that seemingly fundamental metabolic enzymes may have acquired additional functions in mediating ecological interactions. This perspective aligns with evolving concepts in molecular ecology that emphasize the multifunctional nature of many microbial proteins.