Recombinant Rhizobium sp. Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; NGR_c01860; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
mscL
Target Protein Sequence
MLNEFKEFIARGNVMDLAVGVIIGAAFTKIVTSVVDDLVMPIVGAITGGGFDFSNYFLPL SANVTAPTLAAARQQGAVFAYGSFITVLINFMILAWIIFLLVKAVNRIRASVEREKAPEP AAPPPEDVRLLSEIRDILKQRA
Uniprot No.

Target Background

Function
A mechanosensitive ion channel that opens in response to membrane stretch. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is MscL and what is its significance in Rhizobium species?

MscL (Large-conductance mechanosensitive channel) is a membrane protein that serves as a pressure relief valve in bacterial cells during hypo-osmotic shock. In Rhizobium species, particularly Rhizobium etli, the MscL ortholog (ReMscL) plays an important role in preventing cell lysis when these soil bacteria encounter sudden decreases in environmental osmolarity. This adaptation is particularly significant for Rhizobium as free-living organisms in the rhizosphere, where osmotic conditions can fluctuate rapidly .

Unlike Escherichia coli, which possesses multiple mechanosensitive channels, Rhizobium etli has a single gene with clear homology to MscS, four MscS-like channels, and one ortholog of MscL (ReMscL), with approximately 44% identity compared to E. coli MscL . The presence and configuration of these channels likely correlate with the bacteria's habitats and ecological niches.

How does the Rhizobium MscL channel differ structurally from other bacterial MscL channels?

Rhizobium etli MscL (ReMscL) shares approximately 44% sequence identity with Escherichia coli MscL, indicating significant structural differences that may reflect adaptations to Rhizobium's specific environmental challenges . While the core functional domains of MscL channels are conserved across bacterial species, the specific amino acid variations in ReMscL likely influence its gating properties, sensitivity to membrane tension, and interactions with membrane lipids.

These structural differences are particularly interesting from an evolutionary perspective, as they may correlate with the number of mechanosensitive channel paralogs present in different microorganisms and their respective ecological niches . The specific structural features that distinguish ReMscL have been investigated through cloning, functional expression, and electrophysiological characterization.

What methods are commonly used to clone and express recombinant Rhizobium MscL?

The cloning and expression of recombinant Rhizobium MscL typically follows these methodological steps:

  • Gene identification and isolation: The MscL gene is identified in the Rhizobium genome using homology-based approaches compared to known MscL sequences.

  • Subcloning: The gene is amplified using PCR with specific primers and subcloned into an appropriate expression vector containing an inducible promoter and affinity tag for purification.

  • Expression host selection: E. coli strains lacking endogenous MscL (MscL-null mutants) are often used as expression hosts to avoid interference from native channels during functional studies .

  • Protein expression: Transformed bacteria are cultured and protein expression is induced, typically using IPTG for systems with lac-based promoters.

  • Verification: Expression is verified through Western blotting using antibodies against the affinity tag or MscL protein.

For functional studies, the recombinant channels are often characterized in E. coli spheroplasts using patch clamp techniques , which allows for direct measurement of channel activity under controlled conditions.

What electrophysiological approaches are optimal for characterizing Rhizobium MscL channels, and what unique challenges do they present?

The optimal electrophysiological approach for characterizing Rhizobium MscL channels involves patch clamp recordings in giant spheroplasts. This methodology presents several unique challenges and considerations:

  • Preparation of viable spheroplasts: Giant spheroplasts must be prepared from E. coli cells expressing recombinant ReMscL by inducing filamentous growth with cephalexin and carefully digesting the cell wall with lysozyme while maintaining osmotic support .

  • Patch stability: The mechanical sensitivity of these channels means that maintaining stable patches under varying pressure conditions is technically challenging and requires precise control of pipette pressure.

  • Pressure calibration: Applied pressure must be carefully calibrated and monitored to generate reproducible stimulus-response relationships.

  • Single-channel resolution: High-resolution recordings are necessary to distinguish between subconductance states during the gating process, requiring low-noise recording conditions.

  • Solution conditions: Ionic conditions must be optimized to maximize signal-to-noise ratios while maintaining physiological relevance.

When properly implemented, these techniques allow researchers to determine critical parameters such as pressure threshold for activation, conductance, gating kinetics, and modulation by various factors such as pH, membrane composition, and chemical agents .

How do arachidonic acid and gadolinium ions modulate Rhizobium MscL gating, and what mechanistic insights have been gained?

Arachidonic acid (AA) and gadolinium ions (Gd³⁺) have been found to modulate Rhizobium etli MscL (ReMscL) gating through distinct mechanisms:

Arachidonic Acid Facilitation:

  • AA facilitates ReMscL activation, suggesting it lowers the energy barrier for channel opening

  • The mechanism appears to involve stabilization of the partially expanded conformational state of the protein

  • This effect is concentration-dependent and reversible

  • The facilitation by AA may reflect specific interactions with the channel protein or alterations in membrane properties that influence tension sensing

Gadolinium Ion Inhibition:

  • Gd³⁺ ions exert a reversible inhibitory effect on ReMscL

  • Even at trace concentrations, Gd³⁺ appears to stabilize the partially expanded conformation of the protein

  • This inhibition likely involves specific binding to negatively charged residues in the channel

  • The effect may be mediated through alterations in membrane mechanics or direct interactions with the channel protein

These modulatory effects provide valuable insights into the conformational transitions during MscL gating and suggest potential approaches for pharmacological manipulation of channel activity. The differential effects of these modulators also reveal the importance of the partially expanded conformational states in the complete gating cycle of MscL channels.

What are the current approaches for studying MscL gating mechanisms, and how might they be applied to Rhizobium MscL?

Current approaches for studying MscL gating mechanisms integrate computational modeling with experimental validation:

  • Molecular Dynamics Simulations (MDS): These serve as a "special microscope" providing atomic-level details on the gating process. For Rhizobium MscL, these simulations could reveal specific conformational transitions during channel opening and the influence of the lipid environment .

  • Site-Directed Mutagenesis: Systematic mutation of key residues allows determination of their roles in gating. Applying this approach to ReMscL could identify unique functional motifs compared to E. coli MscL.

  • Förster Resonance Energy Transfer (FRET): This technique measures distances between labeled residues during gating transitions, providing dynamic structural information .

  • Small Molecule Modulators: Testing compounds that alter channel function can provide mechanistic insights. The identified effects of arachidonic acid and gadolinium on ReMscL exemplify this approach .

  • Reconstitution in Artificial Membranes: This approach allows control of lipid composition to determine how membrane properties influence gating.

Since the fully open-channel MscL structure has not been experimentally determined, combining these approaches is essential for developing a comprehensive understanding of Rhizobium MscL gating mechanisms .

How does the pH sensitivity of Rhizobium MscL compare to other bacterial MscL channels, and what are the methodological considerations for investigating this property?

Research has identified a slight pH dependence for Rhizobium etli MscL (ReMscL) activation, suggesting that specific titratable residues influence channel gating . When investigating pH sensitivity of MscL channels, researchers should consider:

  • Buffer selection: Buffers must maintain stable pH while not introducing confounding effects on membrane properties or channel function.

  • pH range: Testing should cover physiologically relevant ranges (typically pH 5.5-8.0) with careful control of other variables.

  • Pressure protocol standardization: To isolate pH effects from mechanical gating, standardized pressure protocols must be employed across all pH conditions.

  • Symmetrical vs. asymmetrical pH changes: Testing pH changes on both sides of the membrane independently can distinguish between effects on cytoplasmic versus periplasmic domains.

  • Statistical analysis: Proper statistical methods must be applied to determine significance of pH-dependent shifts in gating parameters.

Comparative studies between ReMscL and other bacterial MscL channels could reveal evolutionary adaptations to different environmental pH conditions, potentially correlating with the ecological niches of different bacterial species .

What expression systems are most suitable for producing functional recombinant Rhizobium MscL for structural and functional studies?

Several expression systems have been evaluated for producing functional recombinant Rhizobium MscL, each with specific advantages for different research applications:

Expression SystemAdvantagesLimitationsBest Applications
E. coli (MscL-null strains)- High yield
- Established protocols
- Genetic tractability
- Compatible with spheroplast preparation
- Membrane composition differs from Rhizobium
- Post-translational modifications may vary
- Electrophysiological studies
- Mutagenesis screening
- Protein-lipid interaction studies
Rhizobium native expression- Native membrane environment
- Authentic post-translational modifications
- Native interacting partners present
- Lower yield
- More complex genetic manipulation
- Spheroplast preparation more challenging
- Physiological relevance studies
- Identification of native modulators
- In vivo function assessment
Cell-free systems- Rapid production
- Direct incorporation into defined liposomes
- Avoids toxicity issues
- Lower yield
- Higher cost
- Potential folding issues
- Reconstitution studies
- Controlled lipid environment experiments
- Incorporation of non-natural amino acids

For structural studies requiring high protein yield, E. coli expression systems with appropriate optimization of induction conditions, detergent selection, and purification protocols generally provide the best results . For functional studies, expression in E. coli MscL-null mutants followed by patch clamp analysis in giant spheroplasts has proven effective for characterizing channel properties .

How can one optimize osmotic shock assays to evaluate the physiological function of recombinant Rhizobium MscL in bacterial cells?

Optimizing osmotic shock assays for evaluating recombinant Rhizobium MscL function requires careful attention to several methodological aspects:

  • Cell preparation protocol:

    • Cells should be grown to log phase in high osmolarity media

    • Expression of recombinant MscL should be verified by Western blotting

    • Cell density should be standardized across all experimental conditions

  • Shock parameters optimization:

    • The magnitude of osmotic downshock must be calibrated (typically 300-1000 mOsm drops)

    • The rate of osmotic change should be controlled (rapid vs. gradual shifts)

    • Temperature during shock must be standardized (typically 23-37°C)

  • Viability assessment methods:

    • Colony-forming unit (CFU) counts provide direct measure of survival

    • Live/dead fluorescent staining allows for rapid assessment of membrane integrity

    • Release of cytoplasmic markers (e.g., ATP) can quantify lysis extent

  • Controls inclusion:

    • E. coli MscL-null mutants without complementation (negative control)

    • E. coli MscL-null mutants complemented with E. coli MscL (positive control)

    • Expressing non-functional MscL mutants (additional control)

  • Data analysis approach:

    • Survival should be calculated as percentage relative to unshocked controls

    • Multiple biological replicates are essential (minimum n=3)

    • Statistical comparison between different constructs should use appropriate tests

This methodology has been successfully employed to demonstrate that ReMscL prevents the lysis of E. coli null mutant log-phase cells upon rapid osmotic downshock, confirming its functional role as a protective mechanosensitive channel .

What are the best approaches for investigating the relationship between MscL function and symbiotic nitrogen fixation in Rhizobium species?

Investigating the relationship between MscL function and symbiotic nitrogen fixation in Rhizobium species requires integrated approaches spanning molecular genetics, physiology, and symbiotic interactions:

  • Generation of MscL knockout and complemented strains:

    • Create clean MscL deletion mutants in Rhizobium species using homologous recombination

    • Complement with wild-type or modified MscL variants under controlled promoters

    • Construct fluorescently tagged versions for localization studies

  • Osmotic challenge phenotype characterization:

    • Test survival under osmotic shock conditions relevant to soil and rhizosphere environments

    • Monitor growth kinetics under fluctuating osmotic conditions

    • Assess membrane integrity during osmotic transitions

  • Symbiotic interaction assays:

    • Evaluate nodulation efficiency on host legumes

    • Measure nitrogen fixation rates using acetylene reduction assays

    • Assess bacteroid differentiation and persistence in nodules

  • Transcriptomic and metabolomic analyses:

    • Compare gene expression profiles between wild-type and MscL mutants during symbiosis

    • Identify metabolic changes associated with MscL function

    • Map interactions between osmotic adaptation and symbiotic pathways

  • In planta microscopy:

    • Visualize MscL-GFP fusion localization in bacteroids

    • Monitor membrane integrity during symbiosis development

    • Track osmotic conditions in infection threads and symbiosomes

This multifaceted approach can reveal whether MscL function is essential during specific stages of the Rhizobium-legume symbiosis, such as infection thread development, bacteroid differentiation, or adaptation to the symbiosome environment .

How should researchers interpret discrepancies between in vitro electrophysiological data and in vivo functional assays for Rhizobium MscL?

When confronted with discrepancies between in vitro electrophysiological data and in vivo functional assays for Rhizobium MscL, researchers should consider several factors in their interpretation:

  • Membrane environment differences:

    • In vitro systems (patches, liposomes) have simplified lipid compositions compared to native bacterial membranes

    • Native membranes contain specific lipids that may modulate channel function

    • Membrane tension distribution differs between artificial systems and intact cells

  • Protein interaction considerations:

    • In vivo systems contain potential regulatory proteins absent in purified systems

    • Post-translational modifications present in vivo may be lost during purification

    • Protein crowding effects in native membranes can alter channel behavior

  • Methodological limitations assessment:

    • Patch clamp applies tension differently than osmotic shock

    • Timescales of measurement differ between electrophysiology (ms-s) and survival assays (min-hr)

    • Detection limits may miss subtle functional differences

  • Physiological context integration:

    • In vivo function depends on expression level and localization

    • Compensatory mechanisms may mask phenotypes in vivo

    • Environmental conditions in assays may not represent native habitats

When arachidonic acid was found to facilitate ReMscL activation in electrophysiological studies, the physiological relevance required validation in cellular contexts to determine if similar lipid species modulate channel function in vivo . Reconciling such discrepancies often requires developing new experimental approaches that bridge the gap between isolated systems and cellular complexity.

What criteria should be used to evaluate potential chemical modulators of Rhizobium MscL for research applications?

Evaluating chemical modulators of Rhizobium MscL for research applications requires systematic assessment across multiple dimensions:

Evaluation CriterionKey ConsiderationsMeasurement Approach
Specificity- Selectivity for MscL vs. other channels
- Cross-reactivity with other bacterial species
- Off-target effects on membrane properties
- Comparative patch clamp with different channels
- Testing on MscL mutants
- Membrane fluidity measurements
Potency- Effective concentration range
- Concentration-response relationship
- Reversibility of effects
- EC50/IC50 determination
- Hill coefficient calculation
- Washout experiments
Mechanism of Action- Direct binding vs. membrane effects
- Conformational state stabilization
- Allosteric vs. orthosteric interactions
- MDS simulations
- FRET analysis
- Competition binding assays
Physiological Impact- Effects on osmotic shock survival
- Influence on growth kinetics
- Compatibility with symbiotic function
- Viability assays
- Growth curve analysis
- Nodulation/nitrogen fixation tests
Research Utility- Stability in experimental conditions
- Compatibility with imaging/electrophysiology
- Availability and cost
- Shelf-life testing
- Fluorescence interference screening
- Synthesis complexity assessment

Arachidonic acid and gadolinium ions represent two chemical modulators of ReMscL with distinct effects: AA facilitates channel activation while Gd³⁺ exerts reversible inhibition . These compounds appear to stabilize the partially expanded conformation of ReMscL through different mechanisms, making them valuable research tools for probing channel gating states. The ideal chemical modulator would demonstrate high specificity, dose-dependent effects, a well-characterized mechanism, and practical utility in multiple experimental contexts.

How can molecular dynamics simulation data be effectively validated using experimental approaches for Rhizobium MscL?

Effective validation of molecular dynamics simulation (MDS) data for Rhizobium MscL requires strategic integration of computational predictions with experimental measurements:

  • Structural prediction validation:

    • Site-directed spin labeling and electron paramagnetic resonance (EPR) spectroscopy to measure distances between residues

    • Disulfide crosslinking to test proximity of residues during different conformational states

    • Mass spectrometry with limited proteolysis to identify exposed regions in different states

  • Gating mechanism verification:

    • Patch clamp analysis of rationally designed mutants predicted by MDS to alter specific aspects of gating

    • Single-molecule FRET measurements to track conformational changes during gating

    • Substituted cysteine accessibility method (SCAM) to determine residue exposure during gating transitions

  • Energy landscape calibration:

    • Pressure threshold measurements of mutants designed to test energy barriers identified in simulations

    • Temperature-dependent kinetic analysis to extract experimental activation energies

    • Tension-dependent gating analysis to determine work required for channel opening

  • Lipid interaction confirmation:

    • Reconstitution in defined lipid systems to test lipid-specific effects predicted by simulations

    • Fluorescence quenching studies to measure protein-lipid interactions

    • Chemical cross-linking to identify specific lipid binding sites

These validation approaches create an iterative feedback loop: experimental results refine simulation parameters, while improved simulations generate new testable hypotheses. This integrated approach has proven valuable in elucidating MscL gating mechanisms, though the fully open-channel structure remains experimentally elusive and is primarily informed by computational models .

How might understanding Rhizobium MscL function contribute to improving nitrogen fixation efficiency in agricultural applications?

Understanding Rhizobium MscL function could contribute to agricultural applications through several mechanistic pathways:

The USDA-ARS research project on expanding the National Rhizobium Germplasm Resource Collection and determining the most efficient strains for biological nitrogen fixation could benefit from incorporating MscL functional analysis into their strain characterization framework . Testing candidate inoculant strains for optimal MscL function could potentially predict field performance under variable soil moisture conditions.

What research gaps remain in understanding the structure-function relationship of Rhizobium MscL compared to other bacterial MscL channels?

Despite significant advances, several critical research gaps remain in understanding Rhizobium MscL structure-function relationships:

  • High-resolution structural determination:

    • The complete three-dimensional structure of ReMscL in different conformational states (closed, intermediate, and open) has not been resolved

    • Cryo-electron microscopy or X-ray crystallography studies specifically targeting ReMscL are needed

  • Gating mechanism comparative analysis:

    • Detailed comparisons between the gating pathways of ReMscL and other bacterial MscL channels remain incomplete

    • The energetics and kinetics of conformational transitions may differ in ways that reflect ecological adaptations

  • Native lipid interactions characterization:

    • The specific interactions between ReMscL and lipids present in Rhizobium membranes are poorly understood

    • How these interactions differ from those of other bacterial MscL channels remains unclear

  • Physiological role delineation:

    • The precise physiological significance of ReMscL in the Rhizobium lifecycle, particularly during symbiosis, requires further investigation

    • Whether ReMscL function differs between free-living and symbiotic states is unknown

  • Regulatory mechanism identification:

    • Potential regulatory mechanisms that may modulate ReMscL function in response to various environmental signals beyond osmotic pressure remain to be discovered

    • These might include redox state, pH, or symbiosis-specific signals

Addressing these gaps would significantly advance our understanding of how MscL structure and function have evolved across bacterial species to meet specific ecological challenges, particularly in the complex lifecycle of symbiotic nitrogen-fixing bacteria .

What emerging technologies might advance our understanding of Rhizobium MscL dynamics and function in the coming decade?

Several emerging technologies hold promise for transforming our understanding of Rhizobium MscL dynamics and function:

  • Cryo-electron microscopy (Cryo-EM) advances:

    • Improved resolution will allow visualization of subtle conformational changes

    • Time-resolved cryo-EM could capture intermediate states during gating

    • This may finally reveal the elusive fully-open channel structure

  • Artificial intelligence applications:

    • AI-powered structure prediction tools (like AlphaFold) may enable more accurate modeling of MscL conformational states

    • Machine learning algorithms could identify patterns in gating behavior across different conditions

    • These approaches could accelerate discovery of structure-function relationships

  • Single-molecule techniques expansion:

    • Advanced FRET approaches with improved spatial and temporal resolution

    • Force spectroscopy to directly measure tension-dependent conformational changes

    • Single-particle tracking in living cells to monitor MscL dynamics during osmotic challenges

  • In situ structural biology methods:

    • Cellular electron cryotomography to visualize channels in their native membrane environment

    • Correlative light and electron microscopy to link function with structure in intact cells

    • These could reveal how MscL organizes within the bacterial membrane

  • Synthetic biology platforms:

    • Designer cells with orthogonal expression systems for controlled MscL studies

    • Biosensors based on MscL gating to report on membrane tension in vivo

    • Engineered MscL variants with novel properties for mechanistic studies

These technologies will enable researchers to move beyond static structural snapshots toward a dynamic understanding of how Rhizobium MscL functions in its natural context, potentially revealing unexplored roles in bacterial physiology and symbiotic relationships .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.