Recombinant Rhizobium sp. Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lspA; NGR_c00270; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
lspA
Target Protein Sequence
MSERNTLFSRPLPIALFILVALVADQAIKYLVEAFLPFQEAVPVVPMLALYRTYNYGVAF SMLSGMEGWFIVGMRLAVVAFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYV IDYILFHTATWSFAVFNLADSFITVGAGAIILDELLQTKKTRSLKL
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Lipoprotein signal peptidase (LspA) and what is its primary function?

Lipoprotein signal peptidase (LspA), also known as Signal peptidase II (SPase II), is an aspartyl protease that performs a critical step in the lipoprotein-processing pathway. Its primary function is to cleave the transmembrane helix signal peptide of lipoproteins after the lipid modification has been added . This enzyme contains a catalytic dyad and 14 additional highly conserved residues surrounding the active site, indicating strong evolutionary conservation of its function . LspA represents an essential component of the bacterial lipoprotein processing machinery, particularly in Gram-negative bacteria where it plays a vital role in cellular viability and in Gram-positive bacteria where it contributes significantly to virulence .

How is LspA structurally characterized across different bacterial species?

LspA exhibits notable structural conservation across bacterial species, particularly within the Rhizobiales group of alpha-proteobacteria. In Rhizobium sp. strain NGR234, the full-length LspA protein consists of 166 amino acids . The protein contains characteristic features including a lipoprotein signal peptide at the N-terminus with a hydrophobic stretch followed by an invariant cysteine within the lipobox motif .

The enzyme contains several conserved domains, including:

  • A catalytic dyad essential for its proteolytic function

  • Highly conserved periplasmic helix (PH) region

  • A β-cradle structure that works with the PH to "clamp" substrates in place

Structural analyses of LspA from different species such as Pseudomonas aeruginosa (LspPae) and Staphylococcus aureus (LspMrs) reveal conservation of essential residues and domains necessary for SPase II activity in lipoprotein processing .

How does the amino acid sequence of Rhizobium sp. LspA compare to other bacterial species?

The amino acid sequence of Rhizobium sp. (strain NGR234) LspA is:

MSERNTLFSRPLPIALFILVALVADQAIKYLVEAFLPFQEAVPVVPmLALYRTYNYGVAFSmLSGMEGWFIVGMRLAVVAFVLWLWRRTPKDRFFAHLGYAMIIAGALGNLVDRLLFGYVIDYILFHTATWSFAVFNLADSFITVGAGAIILDELLQTKKTRSLKL

Alignment studies of LspA sequences across bacterial species reveal highly conserved residues and domains that are essential for SPase II activity . When comparing LspA orthologs:

  • Within the Rhizobiales group, LspA shows high conservation based on shared synteny and protein sequences

  • Outside the Rhizobiales group, sequence similarities tend to be lower

  • Critical functional domains remain conserved across diverse bacterial species, particularly the catalytic residues and active site components

This high degree of conservation suggests evolutionary pressure to maintain the fundamental function of this enzyme across bacterial lineages.

What expression systems are recommended for producing recombinant LspA?

Based on research protocols documented in the literature, several expression systems have proven effective for producing recombinant LspA:

E. coli expression system:

  • The pET28b vector with an N-terminal 6xHis tag and thrombin cleavage sequence has been successfully used for expressing Pseudomonas aeruginosa LspA

  • Heterologous expression of Rickettsia typhi LspA in E. coli has been demonstrated, allowing functional complementation studies

Recommended protocol:

  • Clone the LspA gene into an appropriate expression vector (e.g., pET28b)

  • Transform into a suitable E. coli strain optimized for membrane protein expression

  • Induce expression at reduced temperatures (16-20°C) to facilitate proper folding

  • Extract and purify using detergent solubilization (e.g., FC12 detergent micelles have been used successfully)

When working with recombinant LspA, it's important to consider that as a membrane protein, it requires appropriate detergents or membrane mimics to maintain its native conformation and activity during purification and subsequent studies.

How can researchers assess the conformational dynamics of LspA?

Researchers have employed several complementary techniques to investigate the conformational dynamics of LspA:

Molecular Dynamics (MD) Simulations:

  • MD simulations have revealed that the periplasmic helix of LspA fluctuates on the nanosecond timescale

  • This approach can identify conformational states not observed in crystal structures

Electron Paramagnetic Resonance (EPR) Spectroscopy:

  • Both continuous-wave (CW) EPR and Double Electron-Electron Resonance (DEER) have been used effectively

  • For CW EPR: Prepare singly labeled LspA proteins in detergent micelles

  • For site-directed spin labeling: Introduce cysteine residues via PIPE Mutagenesis or QuikChange methods

Crystallography:

  • X-ray crystallography with bound antibiotics (e.g., globomycin, myxovirescin) has provided insights into LspA conformations

Hybrid approach methodology:

  • Generate cysteine mutants at strategic positions (particularly in the periplasmic helix region)

  • Label with spin probes

  • Perform CW EPR to assess mobility at room temperature

  • Use DEER for distance measurements between labeled sites

  • Validate and complement experimental findings with MD simulations

This multi-technique approach has revealed that LspA samples multiple conformations (closed, intermediate, and open) with varying populations in different states (apo, antibiotic-bound) .

What functional assays can be used to validate recombinant LspA activity?

Several functional assays have been successfully employed to validate the biological activity of recombinant LspA:

Globomycin resistance assay:

  • Overexpression of functional LspA in E. coli confers increased resistance to globomycin (an antibiotic that specifically inhibits LspA)

  • This provides a straightforward method to confirm SPase II activity

Genetic complementation:

  • Temperature-sensitive E. coli mutants (e.g., E. coli Y815) that have defective endogenous LspA can be used

  • Complementation with recombinant LspA that restores growth at non-permissive temperatures confirms functional activity

Lipoprotein processing assay:

  • Express a model lipoprotein substrate with a detectable tag

  • Co-express with recombinant LspA

  • Analyze processing by gel shift assays or mass spectrometry to detect signal peptide cleavage

Enzymatic activity assay protocol:

  • Prepare membrane fractions containing recombinant LspA

  • Incubate with synthetic peptide substrates mimicking lipoprotein signal sequences

  • Monitor cleavage products using HPLC or mass spectrometry

  • Compare activity against known inhibitors like globomycin as controls

These assays provide complementary approaches to validate that recombinant LspA possesses the expected biological activity as a type II signal peptidase.

How does the conformational flexibility of LspA relate to its function?

LspA exhibits remarkable conformational dynamics that are directly linked to its functional mechanism. Research combining molecular dynamics simulations and EPR spectroscopy has revealed:

Key conformational states:

  • Closed conformation: The most dominant in the apo state, where the periplasmic helix (PH) occludes the charged active site from the lipid bilayer

  • Intermediate conformation: Stabilized by antibiotic binding, with the PH in a more open position

  • Open conformation: Required for substrate binding, creating a trigonal cavity where lipoprotein substrates can enter

Functional significance:
The nanosecond timescale fluctuations of the periplasmic helix facilitate an equilibrium between these states, which is critical for:

  • Protecting the charged active site residues from the hydrophobic membrane environment when no substrate is present

  • Allowing substrate access to the active site when in the open conformation

  • Providing a flexible and adaptable active site that can accommodate various lipoprotein substrates

This conformational plasticity explains how LspA can process diverse lipoprotein substrates despite having highly conserved active site residues. The enzyme samples all three conformations (closed, intermediate, and open) in all states, but the populations of each conformation vary depending on whether the enzyme is in apo form or bound to substrates/inhibitors .

What is known about the catalytic mechanism of LspA?

LspA functions as an aspartyl protease with a distinct catalytic mechanism:

Catalytic components:

  • A catalytic dyad consisting of two aspartic acid residues is essential for proteolytic activity

  • 14 additional highly conserved residues surround the active site and contribute to substrate binding and catalysis

Substrate binding model:

  • The β-cradle and periplasmic helix (PH) work together to "clamp" the substrate in place

  • The diacylglyceryl moiety of the lipoprotein substrate anchors into the membrane

  • The signal peptide positions into the active site for cleavage

Catalytic cleavage:

  • The substrate enters when LspA adopts the open conformation

  • The enzyme transitions to the intermediate "clamped" conformation

  • The catalytic aspartate residues coordinate a water molecule

  • Nucleophilic attack by activated water on the scissile peptide bond

  • Cleavage occurs, releasing the signal peptide

Antibiotic inhibition:
Antibiotics like globomycin bind to the active site and stabilize the intermediate conformation, preventing both substrate binding and catalytic activity . The extensive conservation of active site residues explains why resistance mutations are rare - mutations that would impede antibiotic binding would likely also interfere with substrate binding and enzyme function .

How do different conformational states of LspA influence antibiotic and substrate binding?

Research using crystal structures, MD simulations, and EPR studies has revealed important insights into how LspA's conformational states affect interactions with both substrates and antibiotics:

Conformational state influences:

Conformational StateDistance between β-cradle and PHFunctional SignificancePredominant Condition
Closed~6.2 ÅOccludes active site from membraneDominant in apo state
IntermediateModerate distance"Clamped" substrate position; stabilized by antibioticsMost populated in globomycin-bound state
OpenLargest distanceCreates trigonal cavity for substrate entryMinor population, required for substrate binding

Antibiotic binding modes:

  • Multiple binding modes are possible with antibiotics like globomycin

  • The dominant conformation with antibiotic bound shows the periplasmic helix in a more open position than the apo state

  • Different antibiotics (globomycin vs. myxovirescin) can induce different conformations of the periplasmic helix while maintaining similar interactions with the catalytic dyad

Substrate accommodation:

  • The open conformation is the only one that sterically allows prolipoprotein substrate to enter the active site

  • The intermediate "clamped" conformation is proposed to hold the substrate in the correct orientation for cleavage

  • The conformational flexibility explains how LspA can process a variety of lipoprotein substrates with different signal peptide sequences

This conformational plasticity is essential for LspA function and provides insights for designing inhibitors that could lock the enzyme in non-functional conformations.

How does LspA contribute to bacterial symbiotic relationships?

LspA plays a crucial role in bacterial symbiotic relationships, particularly in nitrogen-fixing rhizobium-legume symbioses:

Role in Sinorhizobium meliloti symbiosis:

  • S. meliloti serves as a model alpha-proteobacterium for investigating microbe-host interactions, particularly nitrogen-fixing rhizobium-legume symbioses

  • Successful infection requires complex coordination between host and endosymbiont, including bacterial production of exopolysaccharide-I (EPS-I)

  • The lipoprotein processing pathway, including LspA, contributes to effective symbiosis by helping bacteria adapt to living within host plants

Symbiotic impact:

  • Proper processing of bacterial lipoproteins is essential for establishing and maintaining symbiotic relationships

  • Disruption of lipoprotein processing pathways can lead to symbiosis defects

  • In Medicago sativa seedlings inoculated with wild-type or defective strains, proper lipoprotein processing influences symbiotic efficiency

Mechanism of influence:

  • LspA processes lipoproteins that may be involved in signaling pathways crucial for symbiosis

  • Properly processed lipoproteins contribute to bacterial adaptation to the "stresses" of the host plant environment

  • LspA activity affects expression of genes related to exopolysaccharide production, which is necessary for successful host colonization

The critical nature of LspA in symbiotic relationships highlights the importance of properly functioning lipoprotein processing machinery for beneficial bacterial-host interactions.

What is the significance of LspA in bacterial pathogenesis?

LspA plays a significant role in bacterial pathogenesis, particularly through its impact on bacterial survival and virulence:

Essential role in Gram-negative bacteria:

  • LspA is essential for viability in many Gram-negative bacteria, making it critical for pathogen survival

  • Proper lipoprotein processing through LspA is necessary for maintaining membrane integrity and function

Contribution to virulence in Gram-positive bacteria:

  • While not always essential for survival in Gram-positive bacteria, LspA is important for virulence

  • In Rickettsia typhi, lipoprotein processing by SPase II is critical for intracellular growth and virulence

Pathogenesis mechanisms:

  • LspA processes lipoproteins that may function as virulence factors

  • Properly processed lipoproteins contribute to bacterial adhesion, invasion, and immune evasion

  • The transcriptional patterns of lipoprotein processing genes (including lspA) during infection suggest they play key roles in establishing infection

Experimental evidence:

  • Higher transcriptional levels of lspA and other lipoprotein processing genes at pre-infection time points indicate their importance for initiating infection

  • Only metabolically active pathogens with functional lipoprotein processing can successfully induce host cell phagocytosis and establish infection

Understanding LspA's role in pathogenesis provides insights into bacterial infection mechanisms and potential therapeutic targets for intervention.

How do the expression patterns of LspA compare with other lipoprotein processing enzymes during bacterial growth cycles?

Research on expression patterns reveals distinct relationships between LspA and other lipoprotein processing enzymes during bacterial growth and infection:

Coordinated expression patterns:

  • In Rickettsia typhi, real-time quantitative RT-PCR monitoring of lspA (encoding SPase II), lgt (encoding prolipoprotein transferase), and lepB (encoding type I signal peptidase) shows differential expression during various stages of rickettsial intracellular growth

  • lspA and lgt, both involved in lipoprotein processing, demonstrate similar levels of expression

  • lepB, involved in non-lipoprotein secretion, shows higher expression levels, suggesting it is the major signal peptidase for general protein secretion

Temporal expression patterns:

Growth StagelspA Expressionlgt ExpressionlepB ExpressionSignificance
Pre-infectionHighestHighestHighestIndicates requirement for metabolically active bacteria to initiate infection
Early infectionModerateModerateHighSupports establishment of infection
Mid-infectionVariableVariableHighMaintenance of infection
Late infectionVariableVariableHighBacterial replication and spread

Biological significance:

  • The higher transcriptional level of all three genes at pre-infection time points indicates that only live and metabolically active bacteria are capable of infection and inducing host cell phagocytosis

  • The expression pattern supports in silico predictions that out of 89 secretory proteins in R. typhi, only 14 are lipoproteins, explaining why LepB shows higher expression than LspA

These expression patterns highlight the coordinated but distinct roles of different signal peptidases during bacterial growth and infection cycles.

Why is LspA considered a promising target for antibiotic development?

LspA presents several characteristics that make it an exceptionally promising target for new antibiotic development:

Target validation factors:

  • Essential in Gram-negative bacteria: LspA is required for viability in many Gram-negative pathogens

  • Important for virulence: While not always essential for survival in Gram-positive bacteria, LspA is critical for virulence

  • Highly conserved: The catalytic site and key functional residues show remarkable conservation across bacterial species

Resistance barrier advantages:

  • Low potential for resistance development: The extensive conservation of active site residues means that mutations to impede antibiotic binding would likely also interfere with the enzyme's essential function

  • Novel target: Current antibiotics rarely target the lipoprotein processing pathway, providing a new mechanism of action to combat resistant bacteria

Practical considerations:

  • Targetable active site: The structure and dynamics of LspA's active site have been well-characterized, facilitating structure-based drug design

  • Proven druggability: Existing molecules like globomycin and myxovirescin have demonstrated inhibition of LspA, validating it as a druggable target

  • Membrane localization: As a membrane-bound enzyme, LspA is potentially accessible to antibiotics without requiring cellular penetration

The combination of these factors makes LspA an attractive target for developing novel antibiotics with potentially lower resistance development rates than conventional antibiotics.

What are the mechanisms of action for known LspA inhibitors?

Several inhibitors of LspA have been identified and characterized, providing insights into potential mechanisms for therapeutic intervention:

Globomycin:

  • Mechanism: Globomycin binds to the active site of LspA and stabilizes an intermediate conformation that prevents both substrate binding and catalytic activity

  • Binding mode: It interacts with the catalytic dyad while inducing a specific conformation of the periplasmic helix

  • Conformational effect: Globomycin binding results in multiple conformational states, with the dominant state having the periplasmic helix in a more open position than in the apo state

Myxovirescin:

  • Mechanism: Similar to globomycin, myxovirescin binds to LspA's active site

  • Binding differences: While maintaining similar interactions with the catalytic dyad, myxovirescin can adopt different orientations compared to globomycin

  • Structural impact: A comparison of LspA conformations with the two different antibiotics bound indicates that the periplasmic helix can adopt different conformations depending on the bound inhibitor

Common inhibitory principles:

  • Both inhibitors interact with the catalytic dyad residues

  • They stabilize conformations that prevent proper substrate binding

  • They lock the enzyme in states that cannot complete the catalytic cycle

  • The extensive conservation of the active site makes resistance mutations unlikely without compromising enzyme function

Understanding these mechanisms provides valuable insights for the design of new inhibitors targeting LspA.

What experimental approaches are most effective for screening potential LspA inhibitors?

Several complementary experimental approaches have proven effective for identifying and characterizing potential LspA inhibitors:

In vitro screening approaches:

  • Enzymatic activity assays:

    • Substrate-based assays using fluorogenic or chromogenic peptide substrates

    • Monitoring cleavage of model lipoprotein substrates by mass spectrometry or gel electrophoresis

    • Advantages: Direct measure of inhibition; can determine IC50 values

  • Biophysical binding assays:

    • Thermal shift assays to monitor stabilization of LspA upon inhibitor binding

    • Surface plasmon resonance or isothermal titration calorimetry to measure binding affinities

    • Advantages: Can identify compounds that bind without confirming functional inhibition

Cellular screening approaches:

  • Bacterial growth inhibition:

    • Growth inhibition assays using wild-type bacteria

    • Comparative growth studies with strains overexpressing LspA (resistance indicates on-target activity)

    • Advantages: Identifies compounds with cellular activity and reasonable pharmacokinetic properties

  • Genetic complementation:

    • Using temperature-sensitive E. coli strains (e.g., E. coli Y815) with defective endogenous LspA

    • Compounds that prevent complementation by recombinant LspA at non-permissive temperatures are potential inhibitors

    • Advantages: Provides genetic evidence for on-target activity

Structure-guided approaches:

  • Computational screening:

    • Virtual screening against known LspA structures in different conformational states

    • Molecular dynamics simulations to assess stability of predicted binding modes

    • Advantages: Cost-effective initial filtering of compound libraries

  • Conformational state analysis:

    • EPR spectroscopy to determine if candidate compounds induce similar conformational changes as known inhibitors

    • Crystallography or cryo-EM to visualize inhibitor binding modes

    • Advantages: Provides mechanistic insights into inhibition

A multi-faceted screening strategy combining these approaches is most effective for identifying promising LspA inhibitors with clear on-target activity and favorable properties for further development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.