Recombinant Rhizobium sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium sp. Membrane Protein Insertase YidC

Recombinant Rhizobium sp. Membrane protein insertase YidC (yidC) is a genetically engineered variant of the YidC protein, a conserved bacterial membrane integrase critical for co-translational insertion and folding of membrane proteins. In Rhizobium species, this enzyme facilitates the biogenesis of membrane proteins essential for symbiosis, nutrient transport, and environmental adaptation .

Sequence Details

  • UniProt ID: C3MF49

  • Source Organism: Sinorhizobium fredii (strain NBRC 101917 / NGR234) .

Mechanism of Action

YidC operates by:

  • Mediating insertion of α-helical transmembrane domains into the lipid bilayer .

  • Coordinating with the Sec translocon for larger substrates while functioning independently for small proteins like MscL and F0c .

  • Facilitating hydration/dehydration cycles in its hydrophilic groove during substrate insertion .

Role in Membrane Protein Biogenesis

Synergy with Other Factors

  • YibN Interaction: Recent studies in E. coli reveal YibN as a functional interactor that enhances YidC substrate insertion efficiency by up to 1.8-fold . This suggests potential conserved partnerships in Rhizobium.

  • Lipid Modulation: Overexpression of YidC-associated proteins can induce membrane proliferation, altering lipid composition (e.g., phosphoethanolamine and phosphoglycerol dominance) .

Comparative Insights from Other YidC Systems

FeatureRhizobium sp. YidCEscherichia coli YidC
Substrate SpecificityPresumed symbiosis-related proteinsSec-dependent proteins, F0c, Pf3 coat
Structural MotifsConserved 5-TMD core Hydrophilic cavity in inner leaflet
Genetic MutationsNot reportedT362I/G512S mutations enhance VKORc1 assembly

Challenges and Future Directions

  • Knowledge Gaps: Functional studies on Rhizobium YidC remain sparse compared to E. coli or Bacillus systems .

  • Biotechnological Potential: Engineered YidC variants could optimize membrane protein production for industrial applications, leveraging insights from E. coli adaptation studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; NGR_c00820; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-592
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
yidC
Target Protein Sequence
MMENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQQVQPQQGGQQPAPGQ ALPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLKLKGYHETVDPKSPVIT LFSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTPATPVTLTYTNDKGITFA RTISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTPSIYVLHEGFIGVAGGSLQ EVGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETPFDIRFSHFTDGRPRFQSDY KGDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPKFEKLIDWGWFWFITQPMFKM MDFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMANMKKVQPKMEELKKKFGDDRMG LQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIYITIEMRHAPFFGWIRDLSAPDP TTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRMNPTPPDPTQAMLFTWMPLVFTFM LASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIELFDNLKGLFTKRPKPAE
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Facilitates the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of YidC in bacterial systems?

YidC is a membrane protein insertase that plays an essential role in the biogenesis of membrane proteins. Structurally, YidC contains multiple transmembrane segments, with the first transmembrane helix (TM1) serving as a critical component for its function. The protein functions both independently and in conjunction with the Sec translocon to facilitate the insertion of proteins into the cytoplasmic membrane .

YidC also possesses a foldase activity that promotes the proper assembly of membrane protein complexes. This dual role as both insertase and foldase makes YidC crucial for membrane protein biogenesis . Specifically, YidC can assist in the correct folding of periplasmic domains of membrane proteins, including penicillin binding proteins (PBPs), which are critical for peptidoglycan synthesis .

The structural organization of YidC includes several transmembrane domains, with research suggesting that the first transmembrane helix (TM1) may have a species-specific functional role, potentially in interactions with the Sec translocon to enable YidC to perform its chaperone function .

How do YidC-substrate interactions occur at the molecular level?

YidC interacts with various substrate proteins through specific molecular mechanisms. The protein recognizes and inserts so-called "YidC-only" substrates independently of the Sec translocon . Recent in vitro experiments have demonstrated that YidC facilitates the insertion of several substrates, including Pf3 coat protein, M13 procoat, and F0c subunit of ATP synthase .

The molecular basis for these interactions involves the transmembrane segments of YidC, which create a hydrophilic groove that can accommodate the transmembrane segments of substrate proteins. During membrane insertion, YidC likely undergoes conformational changes to facilitate the lateral movement of substrate proteins into the lipid bilayer.

Experimental evidence using inverted membrane vesicles (INVs) has shown that YidC directly contributes to the membrane insertion of various substrates. Protease protection assays reveal membrane-protected fragments that indicate successful insertion of these substrates into the membrane .

What are the known YidC substrates in bacterial systems?

YidC assists in the membrane insertion of numerous substrate proteins. Well-characterized YidC substrates include:

  • M13 procoat protein: Enhanced synthesis observed during YidC co-expression studies

  • Pf3 coat protein: Shows YidC-dependent membrane insertion

  • F0c subunit of F1-F0 ATP synthase: Demonstrates increased synthesis in the presence of YidC

  • SecG protein: Exhibits YidC-stimulated membrane insertion with multiple topological orientations

Additionally, YidC appears to be involved in the proper folding of penicillin binding proteins (PBPs), which contain a single transmembrane segment and a large periplasmic domain. Interestingly, YidC depletion affects the folding of these proteins without altering their total amount in the membrane .

Recent research has also demonstrated that YidC plays a conserved role in the biogenesis of respiratory chain complexes, with YidC depletion significantly affecting these complexes .

How can recombinant YidC be effectively expressed and purified from bacterial systems?

The effective expression and purification of recombinant YidC requires careful consideration of expression systems and purification strategies. Based on current research methodologies:

Expression Systems:

  • The pBAD expression system under arabinose regulation has proven effective for controlled expression of YidC

  • E. coli strains like JW2806 have been successfully used for YidC expression with SILAC-labeling for quantitative proteomics

Purification Protocol:

  • Express His-tagged YidC in suitable E. coli strain with appropriate induction (e.g., 0.2% L-arabinose)

  • Harvest cells and isolate membrane fractions through differential centrifugation

  • Solubilize membrane proteins using mild detergents such as n-dodecyl-β-D-maltoside (DDM)

  • Perform affinity chromatography using Ni-NTA agarose beads

  • Wash extensively to remove non-specific binding

  • Elute with imidazole gradient buffer

  • Confirm purity by SDS-PAGE and blue-native PAGE analysis

This approach allows for the isolation of homogeneous YidC suitable for structural and functional studies. Blue-native PAGE has been particularly useful for analyzing protein-protein interactions, such as the YidC-YibN complex formation .

What methods are most effective for studying YidC membrane insertion activity?

Several complementary methodologies have proven effective for studying YidC insertion activity:

In Vivo Co-expression Studies:
Co-expression of YidC with known substrate proteins, followed by quantitative Western blot analysis, provides valuable insights into YidC's insertase activity. This approach has demonstrated that YidC enhances the synthesis of substrates like M13 procoat-Lep, Pf3-23Lep, and F0c .

In Vitro Translation/Insertion Assays:

  • Prepare inverted membrane vesicles (INVs) from strains expressing or depleted of YidC

  • Conduct in vitro translation of substrate proteins in the presence of these INVs

  • Assess membrane insertion through protease protection assays

  • Quantify membrane-protected fragments (MPFs) to measure insertion efficiency

This method has revealed that INVs enriched for YibN support a 1.5-1.8-fold stimulation of insertion for substrates like Pf3 coat, M13 procoat H5, and F0c compared to control INVs .

Protease Protection Assays:
After in vitro translation and membrane insertion, treatment with proteinase K generates membrane-protected fragments that can be analyzed by SDS-PAGE and autoradiography. The pattern and intensity of these fragments provide information about the topology and efficiency of membrane insertion .

How can researchers detect YidC-protein interactions reliably?

Several complementary techniques have proven reliable for detecting YidC-protein interactions:

Proximity-dependent Biotin Identification (BioID):
This approach has been successfully implemented to identify proteins in close proximity to YidC in a cellular context. The technique involves:

  • Generating a YidC-BirA fusion protein

  • Expressing this construct in cells supplemented with biotin

  • Biotinylation of proximal proteins by the BirA ligase

  • Isolation of biotinylated proteins using streptavidin affinity chromatography

  • Identification by mass spectrometry

This method successfully identified YibN as a significant interactor of YidC, along with other known associates like FtsH, HflK, and HflC .

Affinity Pulldown with SILAC Labeling:
Stable Isotope Labeling with Amino acids in Cell culture (SILAC) combined with affinity pulldown provides quantitative assessment of protein interactions:

  • Label cells expressing His-tagged YidC with heavy isotopes (e.g., Lys4)

  • Label control cells with light isotopes (e.g., Lys0)

  • Perform affinity pulldown using Ni-NTA agarose

  • Analyze isolated proteins by LC-MS/MS

  • Calculate enrichment ratios to distinguish specific from non-specific interactions

Using this approach, YibN was found to be >20-fold enriched in YidC pulldowns compared to background .

Blue-native PAGE Analysis:
This technique allows visualization of native protein complexes:

  • Purify proteins of interest to homogeneity in appropriate detergent

  • Combine proteins to allow complex formation

  • Analyze by blue-native PAGE

  • Identify complexes based on mobility shifts

This method confirmed the direct interaction between purified YidC and YibN, showing a distinctive band (labeled YY) when both proteins were incubated together .

What is the relationship between YidC and YibN, and what are its functional implications?

YibN has emerged as a significant interactor of YidC with important functional implications for membrane protein biogenesis. Multiple lines of evidence establish this interaction:

Interaction Evidence:

  • Proximity-dependent biotinylation identified YibN as the protein with the highest spectral counts in YidC-BioID experiments

  • Reciprocal affinity pulldowns showed >20-fold enrichment of YibN with His-tagged YidC and >50-fold enrichment of YidC with His-tagged YibN

  • Blue-native PAGE analysis demonstrated that purified YidC and YibN form a stable complex in detergent

  • The YibN transmembrane segment (residues 1-29) is critical for this interaction, suggesting it occurs within the hydrophobic interior of the lipid bilayer

Functional Implications:
YibN enhances YidC's insertase activity in several ways:

  • Augmentation of YidC substrate synthesis:

    • Co-expression of YibN significantly increases the synthesis of known YidC substrates including M13 procoat-Lep, Pf3-23Lep, and F0c

    • This effect is specific to YidC substrates, as proteins like YajC and YhcB, which are not YidC-dependent, show no enhanced synthesis

  • Stimulation of membrane insertion:

    • In vitro translation/insertion assays using inverted membrane vesicles (INVs) show that YibN-enriched membranes support 1.5-1.8-fold higher insertion of YidC substrates compared to control membranes

    • This stimulation affects multiple substrates including Pf3 coat, M13 procoat H5, F0c, and different topological variants of SecG

  • Membrane remodeling:

    • YibN overexpression leads to membrane proliferation, circumvolutions, and multilayered structures, primarily affecting the bacterial inner membrane

    • These membrane alterations may create an environment that facilitates YidC-mediated membrane protein insertion

YibN is upregulated when YidC or SecDF-YajC is depleted, suggesting a compensatory role in membrane protein biogenesis under stress conditions .

How does YidC interact with the Sec translocon in the bacterial membrane?

YidC interacts with the Sec translocon to form a functional complex for membrane protein insertion, though it can also function independently. The interaction between YidC and SecY (the central component of the Sec translocon) appears to involve the first transmembrane helix (TM1) of YidC.

Interaction Mechanism:

  • Cross-linking data suggests that the TM1 helix of YidC interacts with SecY, enabling YidC to perform its chaperone function

  • This interaction may be species-specific, as demonstrated by complementation studies where Thermotoga maritima YidC (TmYidC) failed to complement E. coli YidC depletion, potentially due to the inability of TmYidC's TM1 to interact with E. coli SecY

  • A chimeric YidC containing E. coli TM1 fused to T. maritima YidC (YidC61) successfully complemented E. coli growth defects, supporting the importance of TM1 in species-specific Sec interaction

Functional Significance:
The YidC-Sec interaction creates a holotranslocon (HTL) that facilitates the insertion of certain membrane proteins. This complex allows for:

  • Co-translational insertion of membrane proteins

  • Proper folding and assembly of multi-spanning membrane proteins

  • Efficient translocation of periplasmic domains

The dual functionality of YidC (Sec-dependent and Sec-independent) provides versatility in membrane protein biogenesis pathways, allowing the cell to handle diverse substrate requirements.

What are the effects of YidC depletion on cellular physiology and membrane protein complexes?

YidC depletion has profound effects on cellular physiology, particularly on respiratory chain complexes and membrane protein folding:

Experimental Approach for YidC Depletion:
Controlled YidC depletion can be achieved using arabinose-regulated expression systems:

  • Grow cells harboring YidC under arabinose control in the presence of arabinose (0.2%)

  • Harvest, wash, and transfer to glucose-containing medium (0.1%) to repress YidC expression

  • Monitor growth and harvest cells at specific time points for analysis

Physiological Effects:

  • Growth defects: Cells depleted of YidC show significant growth retardation compared to non-depleted controls

  • Respiratory chain impairment: YidC plays a conserved role in the biogenesis of respiratory chain complexes, and its depletion affects these complexes

  • Protein folding defects: In YidC-depleted cells, penicillin binding proteins (PBPs) are not correctly folded even though their total amount in the membrane remains unchanged

  • Proton motive force (PMF) disruption: Depletion of YidC leads to defects in the assembly of enzymes involved in maintaining the PMF, affecting energy metabolism

These observations highlight YidC's essential role not only in membrane protein insertion but also in the proper folding and assembly of membrane protein complexes critical for cellular function.

How does YidC function in Rhizobium compared to model organisms like E. coli?

While the search results don't provide specific information about YidC in Rhizobium species, we can discuss likely similarities and differences based on general Rhizobium biology:

Potential Similarities:

  • The core insertase function of YidC is likely conserved in Rhizobium as it is among diverse bacterial species

  • The interaction with the Sec translocon probably follows similar principles, though with species-specific adaptations

  • YidC in Rhizobium likely maintains its dual role as both an insertase and foldase

Possible Differences:

  • Rhizobium species undergo significant lifestyle transitions between free-living soil bacteria and symbiotic bacteroids within legume nodules

  • These transitions involve extensive metabolic and physiological changes that may require specialized membrane protein biogenesis pathways

  • YidC in Rhizobium might be adapted to handle membrane protein insertion under various environmental conditions including different pH, oxygen levels, and nutrient availability encountered during symbiosis

Research approaches to investigate Rhizobium YidC function could include:

  • Comparative genomic analysis of YidC sequences across Rhizobium species and model organisms

  • Complementation studies using Rhizobium YidC in E. coli YidC depletion strains

  • Generation of conditional YidC depletion systems in Rhizobium to assess phenotypic effects

What role might YidC play in Rhizobium-legume symbiosis?

YidC likely plays several critical roles during Rhizobium-legume symbiosis, though direct experimental evidence is not provided in the search results:

Potential Roles During Symbiosis:

  • Adaptation to Changing Environments:

    • During the transition from soil to nodule, Rhizobium experiences significant environmental changes

    • YidC may be crucial for inserting and folding membrane proteins necessary for adaptation to these changing conditions

    • The stress tolerance mechanisms observed in Rhizobium strains (temperature, pH, salt, drought) may require properly inserted membrane transporters and receptors

  • Nitrogen Fixation Machinery:

    • The nitrogen fixation apparatus includes various membrane-associated components

    • YidC could be essential for the proper assembly of membrane-associated nitrogenase complexes

    • Respiratory protection mechanisms for nitrogenase likely depend on YidC-mediated insertion of cytochrome components

  • Nutrient Exchange:

    • Symbiotic bacteroids exchange nutrients with plant cells across their membranes

    • Transporters for dicarboxylic acids and other nutrients may require YidC for proper insertion

    • The specialized metabolism of bacteroids likely depends on numerous membrane proteins that need YidC for biogenesis

Given that plant rescue of auxotrophic rhizobia involves metabolite exchange across membranes , the proper insertion of the required transporters by YidC would be critical for successful symbiosis.

How is YidC expression regulated during different Rhizobium lifestyle phases?

The regulation of YidC expression in Rhizobium across different lifestyle phases is not directly addressed in the search results, but we can propose likely regulatory mechanisms:

Potential Regulatory Mechanisms:

  • Environmental Response Regulation:

    • Rhizobium species adapt to various environmental conditions including temperature, pH, salt, and drought stress

    • YidC expression might be upregulated during stress conditions to ensure proper membrane protein insertion when membrane integrity is challenged

    • Similar to observations in E. coli where YibN is upregulated upon YidC depletion , Rhizobium likely has compensatory mechanisms for membrane protein biogenesis

  • Symbiosis-Specific Regulation:

    • The transition from free-living to symbiotic state involves extensive transcriptional reprogramming

    • YidC expression might be coordinated with the expression of symbiosis-specific membrane proteins

    • Potential regulation by symbiotic regulators such as NodD or FixK that control other symbiosis genes

  • Metabolic State-Dependent Regulation:

    • Bacteroids have distinct metabolic profiles compared to free-living rhizobia

    • YidC regulation might be linked to metabolic shifts that occur during differentiation

    • The supply of dicarboxylic acids to bacteroids may influence membrane protein composition and thus YidC demand

Research approaches to investigate this regulation could include:

  • Transcriptomic analysis comparing YidC expression across different lifestyle phases

  • Reporter gene fusions to study YidC promoter activity under various conditions

  • Proteomics approaches to measure YidC protein levels during symbiosis establishment

Bioinformatic approaches offer powerful tools for identifying potential YidC substrates across bacterial species:

Sequence-Based Methods:

  • Comparative Genomics of Known Substrates:

    • Identify homologs of confirmed YidC substrates (M13 procoat, Pf3 coat, F0c, etc.) across species

    • Analyze conservation of key sequence features that determine YidC dependence

    • Apply this approach specifically to Rhizobium proteomes to identify likely YidC substrates

  • Hidden Markov Models (HMMs):

    • Develop HMMs based on the sequence characteristics of known YidC substrates

    • Apply these models to predict YidC dependence across bacterial proteomes

    • Similar approaches have been used successfully to identify protein secretion systems and secreted proteins in Rhizobium

Structural Prediction Approaches:

  • Transmembrane Topology Analysis:

    • YidC substrates often have specific topological features

    • Predict transmembrane segments and topology of all proteins in a genome

    • Filter candidates based on features common to known YidC substrates

  • Signal Sequence Analysis:

    • Some YidC-dependent proteins have distinctive signal sequences

    • Tools like SignalP can identify these sequences across proteomes

    • Combined with topology predictions, this can narrow potential substrate lists

Integration with Experimental Data:

  • Proteomics of YidC Depletion:

    • Compare membrane proteomes with and without YidC depletion

    • Proteins depleted from membranes upon YidC depletion are likely substrates

    • Apply quantitative approaches like SILAC for robust identification

  • Interactome Analysis:

    • Extend YidC-BioID approaches across species to identify interacting partners

    • Prioritize conserved interactors for further functional analysis

    • This approach successfully identified YibN as a YidC interactor

Example Workflow for Rhizobium YidC Substrate Prediction:

  • Identify Rhizobium YidC homolog using sequence alignment with E. coli YidC

  • Predict all membrane proteins in Rhizobium genome using topology prediction tools

  • Score proteins based on features of known YidC substrates (hydrophobicity patterns, charge distribution)

  • Prioritize proteins involved in symbiosis-related functions

  • Validate top candidates experimentally using depletion studies and in vitro assays

This systematic approach would significantly advance our understanding of YidC function in Rhizobium and other bacterial species.

What are the emerging technologies that could advance YidC research?

Several cutting-edge technologies show promise for advancing YidC research:

Cryo-Electron Microscopy (Cryo-EM):

  • Enables visualization of YidC-substrate complexes in near-native states

  • Could reveal conformational changes during the insertion process

  • May provide insights into the YidC-YibN complex structure suggested by blue-native PAGE analysis

Single-Molecule Techniques:

  • Fluorescence resonance energy transfer (FRET) to monitor YidC-substrate interactions in real-time

  • Optical tweezers to measure forces involved in membrane protein insertion

  • These approaches could reveal the dynamics and energetics of YidC-mediated insertion

Nanodiscs and Advanced Membrane Mimetics:

  • Reconstitution of YidC in defined lipid environments using nanodiscs

  • Investigation of lipid requirements for optimal YidC function

  • Particularly relevant given the observation that YibN overexpression affects membrane composition and structure

CRISPR-Based Approaches:

  • Generate conditional knockout systems in organisms less amenable to genetic manipulation

  • Create genome-wide screens for YidC genetic interactions

  • Particularly valuable for studying YidC in Rhizobium during symbiosis

Integrative Structural Biology:

  • Combining cryo-EM, X-ray crystallography, and molecular dynamics simulations

  • Could provide comprehensive understanding of YidC conformational states

  • Would help explain the species-specific functions observed with TM1 helix

These technologies could significantly advance our understanding of YidC function across bacterial species, including Rhizobium.

How might understanding YidC function contribute to biotechnological applications?

Understanding YidC function offers several promising biotechnological applications:

Enhanced Recombinant Membrane Protein Production:

  • Co-expression of YidC/YibN could improve production of difficult membrane proteins

  • The 1.5-1.8 fold enhancement observed for YidC substrates could be exploited

  • Particularly valuable for structural biology and pharmaceutical research on membrane proteins

Engineered Rhizobium for Agriculture:

  • Optimized YidC systems could enhance symbiotic efficiency

  • Improved insertion of transporters for nutrient exchange with host plants

  • Potential for creating rhizobia with enhanced stress tolerance for challenging agricultural environments

Synthetic Biology Applications:

  • YidC could be incorporated into minimal cell designs to ensure membrane protein biogenesis

  • Engineered YidC variants with altered substrate specificity could enable novel membrane protein architectures

  • Systems combining YidC and YibN could facilitate membrane remodeling for specialized functions

Antimicrobial Development:

  • YidC is essential in many bacteria but sufficiently different from human homologs

  • Understanding species-specific aspects of YidC function, like the TM1 helix role , could guide development of targeted antimicrobials

  • Compounds that disrupt YidC-substrate interactions could provide novel antibiotics

These applications highlight the translational potential of basic research on membrane protein insertases like YidC.

What are the most pressing unanswered questions about YidC in Rhizobium symbiosis?

Several critical questions remain unanswered regarding YidC's role in Rhizobium symbiosis:

Symbiosis-Specific Regulation:

  • How is YidC expression regulated during the transition from free-living to symbiotic states?

  • Are there symbiosis-specific promoters or regulatory elements controlling YidC expression?

  • Is YidC function modulated by plant-derived signals during nodule development?

Substrate Specificity in Symbiosis:

  • Which symbiosis-specific membrane proteins depend on YidC for insertion?

  • Does YidC help insert the specialized transporters needed for nutrient exchange with host plants?

  • Are there differences in YidC substrate preference between free-living and bacteroid states?

Interaction with Host Systems:

  • Does Rhizobium YidC function affect the plant's perception of the symbiont?

  • Could YidC-dependent processes influence immune responses or compatibility?

  • How does YidC contribute to membrane remodeling during bacteroid differentiation?

Stress Adaptation:

  • How does YidC contribute to the observed stress tolerance of Rhizobium strains to factors like temperature, salt, drought, and herbicides ?

  • Does YidC play a role in adapting to the unique physiological conditions inside nodules?

  • Could enhancing YidC function improve Rhizobium performance under stress?

YidC-YibN Interaction in Rhizobium:

  • Is the YidC-YibN interaction observed in E. coli conserved in Rhizobium?

  • How might this interaction contribute to membrane restructuring during symbiosis?

  • Could this interaction be targeted to enhance symbiotic efficiency?

Addressing these questions would significantly advance our understanding of the molecular mechanisms underlying successful Rhizobium-legume symbiosis and potentially lead to agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.