Recombinant Rhizobium sp. NADH-quinone oxidoreductase subunit K 1 (nuoK1)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence

The full-length nuoK1 (1–102aa) sequence is:
MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG .

Functional Roles in NDH-1

NuoK1 is a hydrophobic subunit in the membrane domain of NDH-1, which spans three transmembrane helices (TM1–TM3) and contains conserved residues critical for proton translocation . Key findings include:

  • Proton Pumping Mechanism:

    • Glu-36 (TM2) and Glu-72 (TM3) are essential for energy coupling. Mutating Glu-36 to alanine abolishes NDH-1 activity, while Glu-72 mutations moderately reduce activity .

    • Cytoplasmic Loop (TM1–TM2): Arg-25, Arg-26, and Asn-27 are critical for proton translocation. Double mutations here drastically impair NDH-1 function .

  • Structural Flexibility: Relocating Glu-36 along TM2 (positions 32, 38–40) retains activity, suggesting helix-phase positioning is more critical than residue position .

Experimental Uses

  • Protein Expression: Used to study NDH-1 assembly and subunit interactions .

  • Enzymatic Assays: ELISA kits (e.g., CSB-CF502237RKX) enable quantification in biochemical studies .

  • Antimicrobial Targeting: Insights into subunit roles guide drug development against bacterial NDH-1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format when placing the order and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipment is preferred, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize the development of your specified tag.
Synonyms
nuoK1; NGR_c10600; NADH-quinone oxidoreductase subunit K 1; NADH dehydrogenase I subunit K 1; NDH-1 subunit K 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
nuoK1
Target Protein Sequence
MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG
Uniprot No.

Target Background

Function
NDH-1 functions as an electron shuttle in the respiratory chain, transporting electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones. In this species, the enzyme's primary electron acceptor is believed to be ubiquinone. This process is coupled with proton translocation, where for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane, thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K 1 (nuoK1) in Rhizobium etli?

NADH-quinone oxidoreductase subunit K 1 (nuoK1) is a protein component of the NADH dehydrogenase I complex in Rhizobium etli. It participates in the electron transport chain and is encoded by the nuoK1 gene. This protein is also known by several synonyms including "NADH dehydrogenase I subunit K 1" and "NDH-1 subunit K 1" with the EC classification number 1.6.99.5 . The protein functions as part of a larger complex that catalyzes the transfer of electrons from NADH to quinones, contributing to cellular energy metabolism in these nitrogen-fixing bacteria.

How does nuoK1 relate to the larger NADH dehydrogenase complex?

The nuoK1 protein serves as one subunit within the multi-component NADH dehydrogenase I complex. While the search results don't provide specific details about nuoK1's position or role within the complex in Rhizobium, similar NADH-quinone oxidoreductases typically function in electron transfer processes. By comparison, the human NAD(P)H dehydrogenase [quinone] (NQO1) forms homodimers and performs two-electron reduction of quinones to hydroquinones . In bacterial systems like Rhizobium, these complexes typically contain multiple subunits that work together to couple NADH oxidation with proton translocation across membranes, contributing to the generation of a proton motive force for ATP synthesis.

What is the genomic context of nuoK1 in Rhizobium species?

Rhizobium etli has a complex genome consisting of a circular chromosome (approximately 5.06 Mbp in strains like R. leguminosarum A1) and multiple plasmids ranging from 154,738 bp to 804,800 bp in length . The nuoK1 gene has been identified with the gene name "nuoK1" and sometimes with the alternative designation "RHE_CH01615" . Rhizobium species typically contain multiple genomic lineages with low recombination rates among strains from diverse parts of the world, indicating that differentiated genomic lineages may comprise a given species, or they may, in fact, represent multiple distinct species . This genomic diversity should be considered when studying nuoK1 across different Rhizobium isolates.

What expression systems are optimal for recombinant nuoK1 production?

Recombinant Rhizobium etli NADH-quinone oxidoreductase subunit K 1 (nuoK1) is commonly expressed using E. coli expression systems . For researchers seeking to produce recombinant nuoK1, the following expression hosts may be considered based on experimental requirements:

Expression HostAdvantagesConsiderations
E. coliFast growth, high yield, well-established protocolsMay require optimization for membrane protein expression
YeastPost-translational modifications, eukaryotic machineryLonger production time, potentially lower yields
BaculovirusComplex protein folding, higher eukaryotic systemTechnical complexity, higher cost
Mammalian CellClosest to native eukaryotic processingMost expensive, lowest typical yields

The commercially available recombinant nuoK1 products are produced in E. coli , suggesting this is a viable expression system for obtaining functional protein. When designing expression constructs, researchers should consider including affinity tags to facilitate purification while ensuring these modifications don't interfere with protein function.

What are the recommended storage conditions for maintaining nuoK1 stability?

To maintain optimal stability and activity of recombinant nuoK1, the following storage conditions are recommended:

  • Store at -20°C for regular use

  • For extended storage, conserve at -20°C or -80°C

  • Working aliquots can be stored at 4°C for up to one week

  • The protein is typically provided in liquid form containing glycerol as a cryoprotectant

  • Repeated freezing and thawing should be avoided as it may lead to protein denaturation and loss of activity

For research requiring consistent protein activity, it is advisable to prepare single-use aliquots upon receipt of the protein to minimize freeze-thaw cycles.

How can researchers verify the functional activity of recombinant nuoK1?

While the search results don't provide specific assays for nuoK1 activity, researchers can consider the following approaches based on general practices for NADH dehydrogenase enzymes:

  • Spectrophotometric assays measuring NADH oxidation (decrease in absorbance at 340 nm)

  • Oxygen consumption measurements using oxygen electrodes

  • Artificial electron acceptor assays using compounds like ferricyanide or dichlorophenolindophenol

  • Reconstitution experiments with other subunits of the NADH dehydrogenase complex

It's important to note that as a single subunit, recombinant nuoK1 may not demonstrate the full enzymatic activity of the complete complex. Therefore, functional verification might require co-expression with other subunits or alternative approaches to assess proper folding and interactions.

How can nuoK1 be studied in the context of Rhizobium-legume symbiosis?

Studying nuoK1 in the context of Rhizobium-legume symbiosis requires understanding the role of energy metabolism in the nitrogen fixation process. Rhizobium leguminosarum strain A1 is commonly used in inoculation experiments with pea (Pisum sativum L.) lines and possesses useful qualities for agricultural applications, such as the ability to nodulate a wide range of pea varieties .

Research approaches might include:

  • Creating nuoK1 knockout or mutant strains to assess impact on symbiotic efficiency

  • Examining nuoK1 expression patterns during different stages of symbiosis

  • Investigating energy metabolism requirements during nodule formation and nitrogen fixation

  • Comparative studies of nuoK1 across different Rhizobium species with varying symbiotic capabilities

The Rhizobium leguminosarum strain A1 genome contains multiple symbiosis-related genes, including nod genes involved in producing lipochitin oligosaccharides (LCOs) or Nod factors that are essential for establishing symbiosis . Understanding how nuoK1 and energy metabolism integrate with these symbiotic processes could provide valuable insights into improving nitrogen fixation efficiency.

What are the structural characteristics that distinguish nuoK1 among NADH dehydrogenase subunits?

While the search results don't provide specific structural information about nuoK1, researchers interested in structural biology approaches might consider:

  • Homology modeling based on related NADH dehydrogenase subunits with known structures

  • Expression and purification strategies optimized for structural studies (X-ray crystallography, cryo-EM)

  • Analysis of conserved domains and motifs across different bacterial species

  • Investigation of protein-protein interactions within the larger NADH dehydrogenase complex

For recombinant proteins like nuoK1, achieving >90% purity is typically necessary for structural studies . Researchers should consider the membrane-associated nature of many NADH dehydrogenase subunits when designing purification protocols, potentially incorporating detergents or amphipols to maintain protein stability.

How does nuoK1 contribute to Rhizobium metabolism under different environmental conditions?

NADH-quinone oxidoreductases play crucial roles in cellular energy metabolism by coupling NADH oxidation to electron transfer and proton translocation. In Rhizobium species, which can exist in both free-living soil bacteria and as symbionts within plant nodules, the regulation and function of these enzymes may vary with environmental conditions.

Research questions to explore might include:

  • How does nuoK1 expression change between free-living and symbiotic states?

  • What is the role of nuoK1 in adaptation to oxygen-limited environments (such as within nodules)?

  • How does nuoK1 function compare between different Rhizobium species and across the phylogenetic continuum observed in Rhizobium taxonomy ?

  • Is there functional redundancy with other NADH dehydrogenase subunits or complexes?

Understanding these aspects could provide insights into both the basic biology of Rhizobium species and potential applications in agricultural biotechnology.

What purification strategies are most effective for recombinant nuoK1?

Based on general principles for recombinant protein purification and the available information on nuoK1:

  • Affinity chromatography is typically the first choice for recombinant proteins with affinity tags

  • For nuoK1 without affinity tags, ion exchange chromatography followed by size exclusion may be appropriate

  • If nuoK1 associates with membranes, detergent solubilization may be necessary

  • The target purity for research applications should exceed 90%

A typical purification workflow might include:

Purification StepPurposeConsiderations
Cell lysisRelease protein from expression hostBuffer composition should maintain protein stability
ClarificationRemove cell debrisCentrifugation speed and time depend on protein localization
Capture chromatographyInitial purificationAffinity tags or ion exchange based on protein properties
Intermediate purificationRemove major contaminantsDifferent selectivity from capture step
PolishingAchieve final puritySize exclusion to separate aggregates and oligomeric states
Quality controlVerify purity and activitySDS-PAGE, Western blot, activity assays

What analytical techniques are recommended for characterizing recombinant nuoK1?

Researchers should consider multiple analytical techniques to fully characterize recombinant nuoK1:

  • SDS-PAGE and Western blotting for purity assessment and identity confirmation

  • Mass spectrometry for accurate molecular weight determination and sequence verification

  • Circular dichroism spectroscopy to assess secondary structure content

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state

  • Thermal shift assays to evaluate protein stability under different buffer conditions

  • Activity assays specific to NADH dehydrogenase function

For integrating nuoK1 research with broader studies of Rhizobium biology, researchers should consider the genomic context. Rhizobium species consist of multiple genomic lineages with low recombination rates among strains from diverse parts of the world , which may influence nuoK1 sequence and functional conservation across isolates.

How can researchers design functional studies to elucidate nuoK1's role in Rhizobium biology?

To understand nuoK1's biological role, researchers could employ several complementary approaches:

  • Gene knockout or knockdown studies to assess phenotypic consequences

  • Complementation experiments to verify phenotype specificity

  • Expression analysis across different growth conditions and symbiotic stages

  • Protein-protein interaction studies to identify binding partners within the NADH dehydrogenase complex

  • Comparative genomics across different Rhizobium species and strains

When designing such studies, researchers should consider the complex genomic organization of Rhizobium species. The genome of Rhizobium leguminosarum strain A1, for example, consists of a 5.06-Mbp circular chromosome and multiple circular plasmids . This genomic complexity and the existence of multiple genomic lineages within Rhizobium species may influence experimental design and interpretation of results.

What are the current limitations in nuoK1 research and how might they be addressed?

Current limitations in nuoK1 research include:

  • Limited functional characterization specifically of the nuoK1 subunit

  • Challenges in expressing and purifying membrane-associated proteins

  • Complexity of studying individual components of multi-subunit complexes

  • Genetic redundancy that may mask phenotypes in single-gene studies

Future approaches to address these limitations might include:

  • Cryo-EM structural studies of the entire NADH dehydrogenase complex from Rhizobium

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics

  • Development of Rhizobium-specific genetic tools for precise genome editing

  • In situ studies examining nuoK1 function during actual plant-microbe interactions

How can nuoK1 research contribute to agricultural applications involving Rhizobium?

Understanding nuoK1 and energy metabolism in Rhizobium could have several agricultural applications:

  • Improving biofertilizer efficiency by enhancing Rhizobium energy metabolism

  • Developing strains with optimized symbiotic nitrogen fixation capabilities

  • Understanding the metabolic requirements for successful plant colonization

  • Identifying targets for enhancing Rhizobium persistence in agricultural soils

Rhizobium leguminosarum strain A1 has been shown to possess useful agricultural qualities, such as being able to nodulate a wide range of pea varieties and overcoming competitive nodulation blocking . Research on metabolic components like nuoK1 could provide insights into these beneficial traits and potentially lead to improved bioinoculants for sustainable agriculture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.