The full-length nuoK1 (1–102aa) sequence is:
MEIGISHYLTVSAILFTLGVFGIFLNRKNVIIILMSVELILLAVNINMVAFSAFLNDITG QVFALFILTVAAAEAAIGLAILVVFYRNRGSIAVEDVNMMKG .
NuoK1 is a hydrophobic subunit in the membrane domain of NDH-1, which spans three transmembrane helices (TM1–TM3) and contains conserved residues critical for proton translocation . Key findings include:
Proton Pumping Mechanism:
Glu-36 (TM2) and Glu-72 (TM3) are essential for energy coupling. Mutating Glu-36 to alanine abolishes NDH-1 activity, while Glu-72 mutations moderately reduce activity .
Cytoplasmic Loop (TM1–TM2): Arg-25, Arg-26, and Asn-27 are critical for proton translocation. Double mutations here drastically impair NDH-1 function .
Structural Flexibility: Relocating Glu-36 along TM2 (positions 32, 38–40) retains activity, suggesting helix-phase positioning is more critical than residue position .
KEGG: rhi:NGR_c10600
STRING: 394.NGR_c10600
NADH-quinone oxidoreductase subunit K 1 (nuoK1) is a protein component of the NADH dehydrogenase I complex in Rhizobium etli. It participates in the electron transport chain and is encoded by the nuoK1 gene. This protein is also known by several synonyms including "NADH dehydrogenase I subunit K 1" and "NDH-1 subunit K 1" with the EC classification number 1.6.99.5 . The protein functions as part of a larger complex that catalyzes the transfer of electrons from NADH to quinones, contributing to cellular energy metabolism in these nitrogen-fixing bacteria.
The nuoK1 protein serves as one subunit within the multi-component NADH dehydrogenase I complex. While the search results don't provide specific details about nuoK1's position or role within the complex in Rhizobium, similar NADH-quinone oxidoreductases typically function in electron transfer processes. By comparison, the human NAD(P)H dehydrogenase [quinone] (NQO1) forms homodimers and performs two-electron reduction of quinones to hydroquinones . In bacterial systems like Rhizobium, these complexes typically contain multiple subunits that work together to couple NADH oxidation with proton translocation across membranes, contributing to the generation of a proton motive force for ATP synthesis.
Rhizobium etli has a complex genome consisting of a circular chromosome (approximately 5.06 Mbp in strains like R. leguminosarum A1) and multiple plasmids ranging from 154,738 bp to 804,800 bp in length . The nuoK1 gene has been identified with the gene name "nuoK1" and sometimes with the alternative designation "RHE_CH01615" . Rhizobium species typically contain multiple genomic lineages with low recombination rates among strains from diverse parts of the world, indicating that differentiated genomic lineages may comprise a given species, or they may, in fact, represent multiple distinct species . This genomic diversity should be considered when studying nuoK1 across different Rhizobium isolates.
Recombinant Rhizobium etli NADH-quinone oxidoreductase subunit K 1 (nuoK1) is commonly expressed using E. coli expression systems . For researchers seeking to produce recombinant nuoK1, the following expression hosts may be considered based on experimental requirements:
| Expression Host | Advantages | Considerations |
|---|---|---|
| E. coli | Fast growth, high yield, well-established protocols | May require optimization for membrane protein expression |
| Yeast | Post-translational modifications, eukaryotic machinery | Longer production time, potentially lower yields |
| Baculovirus | Complex protein folding, higher eukaryotic system | Technical complexity, higher cost |
| Mammalian Cell | Closest to native eukaryotic processing | Most expensive, lowest typical yields |
The commercially available recombinant nuoK1 products are produced in E. coli , suggesting this is a viable expression system for obtaining functional protein. When designing expression constructs, researchers should consider including affinity tags to facilitate purification while ensuring these modifications don't interfere with protein function.
To maintain optimal stability and activity of recombinant nuoK1, the following storage conditions are recommended:
Store at -20°C for regular use
For extended storage, conserve at -20°C or -80°C
Working aliquots can be stored at 4°C for up to one week
The protein is typically provided in liquid form containing glycerol as a cryoprotectant
Repeated freezing and thawing should be avoided as it may lead to protein denaturation and loss of activity
For research requiring consistent protein activity, it is advisable to prepare single-use aliquots upon receipt of the protein to minimize freeze-thaw cycles.
While the search results don't provide specific assays for nuoK1 activity, researchers can consider the following approaches based on general practices for NADH dehydrogenase enzymes:
Spectrophotometric assays measuring NADH oxidation (decrease in absorbance at 340 nm)
Oxygen consumption measurements using oxygen electrodes
Artificial electron acceptor assays using compounds like ferricyanide or dichlorophenolindophenol
Reconstitution experiments with other subunits of the NADH dehydrogenase complex
It's important to note that as a single subunit, recombinant nuoK1 may not demonstrate the full enzymatic activity of the complete complex. Therefore, functional verification might require co-expression with other subunits or alternative approaches to assess proper folding and interactions.
Studying nuoK1 in the context of Rhizobium-legume symbiosis requires understanding the role of energy metabolism in the nitrogen fixation process. Rhizobium leguminosarum strain A1 is commonly used in inoculation experiments with pea (Pisum sativum L.) lines and possesses useful qualities for agricultural applications, such as the ability to nodulate a wide range of pea varieties .
Research approaches might include:
Creating nuoK1 knockout or mutant strains to assess impact on symbiotic efficiency
Examining nuoK1 expression patterns during different stages of symbiosis
Investigating energy metabolism requirements during nodule formation and nitrogen fixation
Comparative studies of nuoK1 across different Rhizobium species with varying symbiotic capabilities
The Rhizobium leguminosarum strain A1 genome contains multiple symbiosis-related genes, including nod genes involved in producing lipochitin oligosaccharides (LCOs) or Nod factors that are essential for establishing symbiosis . Understanding how nuoK1 and energy metabolism integrate with these symbiotic processes could provide valuable insights into improving nitrogen fixation efficiency.
While the search results don't provide specific structural information about nuoK1, researchers interested in structural biology approaches might consider:
Homology modeling based on related NADH dehydrogenase subunits with known structures
Expression and purification strategies optimized for structural studies (X-ray crystallography, cryo-EM)
Analysis of conserved domains and motifs across different bacterial species
Investigation of protein-protein interactions within the larger NADH dehydrogenase complex
For recombinant proteins like nuoK1, achieving >90% purity is typically necessary for structural studies . Researchers should consider the membrane-associated nature of many NADH dehydrogenase subunits when designing purification protocols, potentially incorporating detergents or amphipols to maintain protein stability.
NADH-quinone oxidoreductases play crucial roles in cellular energy metabolism by coupling NADH oxidation to electron transfer and proton translocation. In Rhizobium species, which can exist in both free-living soil bacteria and as symbionts within plant nodules, the regulation and function of these enzymes may vary with environmental conditions.
Research questions to explore might include:
How does nuoK1 expression change between free-living and symbiotic states?
What is the role of nuoK1 in adaptation to oxygen-limited environments (such as within nodules)?
How does nuoK1 function compare between different Rhizobium species and across the phylogenetic continuum observed in Rhizobium taxonomy ?
Is there functional redundancy with other NADH dehydrogenase subunits or complexes?
Understanding these aspects could provide insights into both the basic biology of Rhizobium species and potential applications in agricultural biotechnology.
Based on general principles for recombinant protein purification and the available information on nuoK1:
Affinity chromatography is typically the first choice for recombinant proteins with affinity tags
For nuoK1 without affinity tags, ion exchange chromatography followed by size exclusion may be appropriate
If nuoK1 associates with membranes, detergent solubilization may be necessary
The target purity for research applications should exceed 90%
A typical purification workflow might include:
| Purification Step | Purpose | Considerations |
|---|---|---|
| Cell lysis | Release protein from expression host | Buffer composition should maintain protein stability |
| Clarification | Remove cell debris | Centrifugation speed and time depend on protein localization |
| Capture chromatography | Initial purification | Affinity tags or ion exchange based on protein properties |
| Intermediate purification | Remove major contaminants | Different selectivity from capture step |
| Polishing | Achieve final purity | Size exclusion to separate aggregates and oligomeric states |
| Quality control | Verify purity and activity | SDS-PAGE, Western blot, activity assays |
Researchers should consider multiple analytical techniques to fully characterize recombinant nuoK1:
SDS-PAGE and Western blotting for purity assessment and identity confirmation
Mass spectrometry for accurate molecular weight determination and sequence verification
Circular dichroism spectroscopy to assess secondary structure content
Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to determine oligomeric state
Thermal shift assays to evaluate protein stability under different buffer conditions
Activity assays specific to NADH dehydrogenase function
For integrating nuoK1 research with broader studies of Rhizobium biology, researchers should consider the genomic context. Rhizobium species consist of multiple genomic lineages with low recombination rates among strains from diverse parts of the world , which may influence nuoK1 sequence and functional conservation across isolates.
To understand nuoK1's biological role, researchers could employ several complementary approaches:
Gene knockout or knockdown studies to assess phenotypic consequences
Complementation experiments to verify phenotype specificity
Expression analysis across different growth conditions and symbiotic stages
Protein-protein interaction studies to identify binding partners within the NADH dehydrogenase complex
Comparative genomics across different Rhizobium species and strains
When designing such studies, researchers should consider the complex genomic organization of Rhizobium species. The genome of Rhizobium leguminosarum strain A1, for example, consists of a 5.06-Mbp circular chromosome and multiple circular plasmids . This genomic complexity and the existence of multiple genomic lineages within Rhizobium species may influence experimental design and interpretation of results.
Current limitations in nuoK1 research include:
Limited functional characterization specifically of the nuoK1 subunit
Challenges in expressing and purifying membrane-associated proteins
Complexity of studying individual components of multi-subunit complexes
Genetic redundancy that may mask phenotypes in single-gene studies
Future approaches to address these limitations might include:
Cryo-EM structural studies of the entire NADH dehydrogenase complex from Rhizobium
Systems biology approaches integrating transcriptomics, proteomics, and metabolomics
Development of Rhizobium-specific genetic tools for precise genome editing
In situ studies examining nuoK1 function during actual plant-microbe interactions
Understanding nuoK1 and energy metabolism in Rhizobium could have several agricultural applications:
Improving biofertilizer efficiency by enhancing Rhizobium energy metabolism
Developing strains with optimized symbiotic nitrogen fixation capabilities
Understanding the metabolic requirements for successful plant colonization
Identifying targets for enhancing Rhizobium persistence in agricultural soils
Rhizobium leguminosarum strain A1 has been shown to possess useful agricultural qualities, such as being able to nodulate a wide range of pea varieties and overcoming competitive nodulation blocking . Research on metabolic components like nuoK1 could provide insights into these beneficial traits and potentially lead to improved bioinoculants for sustainable agriculture.