Recombinant Rhizobium sp. NADH-quinone oxidoreductase subunit K 2 (nuoK2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we currently have in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes section, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, kindly consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate your request in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50% and can serve as a reference for your own preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms offer extended shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles to preserve protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production process. Should you have a specific tag type preference, please inform us and we will prioritize developing it according to your requirements.
Synonyms
nuoK2; NGR_c22180; NADH-quinone oxidoreductase subunit K 2; NADH dehydrogenase I subunit K 2; NDH-1 subunit K 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
nuoK2
Target Protein Sequence
MVPLWWHISLGVALFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGRYYADFRGQI FAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the primary electron acceptor for the enzyme is believed to be ubiquinone. The enzyme couples the redox reaction with proton translocation, moving four hydrogen ions across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-quinone oxidoreductase subunit K 2 in Rhizobium species?

NADH-quinone oxidoreductase subunit K 2 (nuoK2) in Rhizobium species is a critical component of the respiratory chain complex I. This protein plays an essential role in energy metabolism by facilitating electron transfer from NADH to quinones. Unlike the conventional nuoK found in many bacteria, the nuoK2 variant in Rhizobium has evolved specialized functions potentially related to symbiotic nitrogen fixation processes. Research suggests that nuoK2 may contribute to the bacterium's ability to adapt to the microaerobic conditions within root nodules, where oxygen levels must be carefully regulated to support nitrogenase activity without inhibiting it. Methodologically, researchers can study its function through comparative genomics with other respiratory chain components and through mutant studies examining physiological impacts under various growth conditions .

How does nuoK2 expression correlate with biological nitrogen fixation (BNF) capacity?

Expression of nuoK2 appears to have significant correlations with BNF capacity in Rhizobium species. Researchers have observed differential expression patterns of respiratory chain components, including nuoK2, between high-nodulation and low-nodulation strains. Quantitative analysis should include RT-qPCR measurements of nuoK2 expression across different growth phases and correlation with nitrogenase activity measurements. Methodologically, this requires careful experimental design with appropriate controls and normalization procedures. Researchers should consider using QTL (Quantitative Trait Loci) analysis, as described in Yang et al. (2017), to identify genetic markers associated with both nuoK2 expression and BNF capacity. This approach has successfully identified markers that explain significant variations in nodulation and nitrogen fixation efficiency .

What techniques are most effective for isolation and purification of recombinant nuoK2?

The isolation and purification of recombinant nuoK2 requires specialized approaches due to its membrane-associated nature. A methodological workflow should include:

  • Optimized expression system selection: E. coli BL21(DE3) strains with modified membranes are often preferred for membrane protein expression.

  • Vector design: Incorporation of affinity tags (His6 or Strep-tag) at either the N- or C-terminus, with careful consideration of tag position to avoid interference with protein folding.

  • Induction conditions: Low-temperature induction (16-20°C) with reduced IPTG concentrations (0.1-0.5 mM) to promote proper folding.

  • Membrane fraction preparation: Gentle lysis followed by ultracentrifugation to separate membrane fractions.

  • Detergent screening: Systematic evaluation of detergents (DDM, LMNG, or GDN) for solubilization efficiency without compromising protein stability.

  • Chromatography sequence: IMAC followed by size exclusion chromatography in detergent-containing buffers.

Researchers should validate protein purity via SDS-PAGE and Western blotting, and confirm functionality through activity assays measuring electron transfer rates .

How does rhizobium inoculation influence the expression and function of nuoK2 in symbiotic relationships?

Rhizobium inoculation significantly alters the metabolic landscape in the rhizosphere, which likely impacts nuoK2 expression and function. Based on current research, the introduction of exogenous rhizobia changes microbial community structures and metabolic networks, suggesting potential regulatory effects on respiratory chain components. Methodologically, researchers should employ a multi-omics approach:

  • Transcriptomics: RNA-seq analysis comparing nuoK2 expression levels between inoculated and non-inoculated conditions.

  • Proteomics: Quantitative proteomic analysis to measure nuoK2 protein abundance and post-translational modifications.

  • Metabolomics: Assessment of changes in redox cofactors and energy metabolites.

  • Comparative analysis: Evaluation across different soybean genotypes with varying BNF capacities, particularly those with QTLs associated with nodulation efficiency.

Research has demonstrated that rhizobium inoculation alters fungal community structures in the rhizosphere, creating complex cross-kingdom interactions that may indirectly affect nuoK2 function through altered microenvironmental conditions . The experimental design should account for these plant-microbe-microbe interactions by including appropriate controls and time-course measurements.

What methodological approaches best resolve the structural and functional differences between nuoK and nuoK2 variants in Rhizobium species?

To effectively resolve structural and functional differences between nuoK and nuoK2 variants, researchers should implement a comprehensive comparative analysis framework:

Structural Analysis Methods:

  • Cryo-EM: High-resolution structural determination of both variants within the respiratory complex.

  • Molecular dynamics simulations: Analysis of protein flexibility and conformational changes during electron transfer.

  • Site-directed mutagenesis: Systematic modification of potentially critical residues identified through sequence alignment.

Functional Comparison Methods:

  • Electron transfer kinetics: Measurement of NADH oxidation rates under varying oxygen tensions.

  • Proton pumping assays: Quantification of proton translocation efficiency.

  • Complementation studies: Cross-complementation of nuoK and nuoK2 mutants to assess functional interchangeability.

This methodological approach should be applied across multiple Rhizobium strains with different symbiotic efficiencies to correlate structural variations with functional outcomes. The experimental design should include statistical validation through multiple biological replicates and appropriate controls to account for strain-specific variations .

How do interactions between nuoK2 and the rhizosphere fungal community affect biological nitrogen fixation efficiency?

Research suggests complex interactions between rhizobial metabolic activities and fungal communities in the rhizosphere. Analysis of these interactions requires sophisticated experimental approaches:

  • Co-culture systems: Establish controlled co-culture systems with Rhizobium expressing nuoK2 and key fungal species identified as biomarkers (such as Cladosporium, Septoria, and Penicillium oxalicum).

  • Metabolite exchange profiling: Use isotope labeling to track carbon and nitrogen flow between bacterial and fungal partners.

  • Transcriptional response analysis: Monitor nuoK2 expression changes in response to fungal exudates.

  • Network analysis: Construct interaction networks between bacterial respiratory genes and fungal community members.

Research has demonstrated that rhizobium inoculation leads to significant shifts in rhizosphere fungal communities, with changes in hub fungi within co-occurrence networks . The table below summarizes key fungal taxa shifts observed in rhizobium-inoculated versus non-inoculated conditions:

Treatment ConditionHub Fungi in NetworkNumber of Network ConnectionsBiomarker Taxa
Non-inoculated (N)Cladosporium, Pyrenochaetopsis, Sporobolomyces, Hannaella, Phaeosphaeria78Mortierella alpina, Gymnoascus, Leucothecium, Zygomycota
Rhizobium-inoculated (R)Phaeosphaeria, Sporobolomyces, Septoria, Edenia, Leptospora130Eurotiales, Trichocomaceae, Septoria, Myrmecridium, Penicillium oxalicum, Mycosphaerella

These community shifts likely influence the microenvironmental conditions surrounding Rhizobium, potentially affecting nuoK2 expression and function through altered oxygen availability, pH, or metabolite concentrations .

What experimental designs best elucidate the impact of nuoK2 mutations on symbiotic performance across different plant genotypes?

To comprehensively assess the impact of nuoK2 mutations on symbiotic performance across plant genotypes, researchers should implement a multi-factorial experimental design:

  • Factorial experimental design:

    • Factor 1: Rhizobium strains (wild-type vs. nuoK2 mutants with varying modifications)

    • Factor 2: Plant genotypes (parental lines and RILs with varying BNF QTLs)

    • Factor 3: Environmental conditions (varying oxygen tensions and nutrient availabilities)

  • Phenotypic measurements:

    • Nodule number, size, and distribution

    • Nitrogenase activity (acetylene reduction assay)

    • Plant biomass and nitrogen content

    • Root architecture modifications

  • Molecular analyses:

    • Expression profiling of symbiosis-related genes in both partners

    • Metabolomic analysis of nodule contents

    • Proteomic analysis of bacteroid fractions

This approach allows for the identification of genotype-specific effects and potential epistatic interactions between plant BNF QTLs and bacterial nuoK2 variants. Research has shown that soybean genotypes carrying different BNF QTLs respond differently to rhizobium inoculation, suggesting that nuoK2 function may have genotype-specific effects on symbiotic performance .

How can high-throughput screening methodologies be optimized to identify nuoK2 variants with enhanced electron transport efficiency?

Optimizing high-throughput screening for enhanced nuoK2 variants requires sophisticated methodological approaches:

  • Library generation:

    • Site-saturation mutagenesis targeting conserved residues

    • Error-prone PCR for random mutagenesis

    • DNA shuffling between nuoK2 variants from different Rhizobium species

  • Screening system development:

    • Colorimetric assays using electron acceptor dyes (e.g., DCPIP or NBT)

    • Growth-based selection under respiratory stress conditions

    • Biosensor strains with reporter genes linked to respiratory efficiency

  • Validation pipeline:

    • Secondary screening with purified components

    • Reconstitution assays in liposomes

    • In vivo assessment in symbiotic conditions

  • Data analysis approach:

    • Machine learning algorithms to identify sequence-function relationships

    • Structural modeling to predict functional impacts of identified mutations

    • Systems biology integration with metabolic models

This methodological framework enables the identification of nuoK2 variants with enhanced performance under symbiotic conditions, potentially leading to improved BNF efficiency. The experimental design should include appropriate statistical controls and validation steps to ensure reproducibility and physiological relevance of identified variants .

What controls are essential when studying nuoK2 function in Rhizobium-legume symbiosis?

When investigating nuoK2 function in symbiotic contexts, the following comprehensive control system is essential:

  • Genetic controls:

    • Wild-type Rhizobium strain (positive control)

    • Complete nuoK2 deletion mutant (negative control)

    • Complemented strain expressing native nuoK2 (restoration control)

    • Strain expressing alternative nuoK variant (specificity control)

  • Host plant controls:

    • Non-inoculated plants (baseline control)

    • Plants inoculated with Fix+ and Fix- control strains

    • Multiple plant genotypes with defined BNF QTL profiles (as seen in the Yang et al. study with high nodulation and low nodulation lines)

  • Environmental controls:

    • Standardized growth conditions with monitored oxygen levels

    • Defined nutrient compositions to prevent nitrogen limitation effects

    • Multiple time points to capture developmental dynamics

  • Analytical controls:

    • Internal standards for gene expression analyses

    • Metabolomic reference compounds

    • Isogenic strains with mutations in related respiratory components

This control framework addresses the complex interactions observed between rhizobial strains and plant genotypes. Research has demonstrated that soybean lines with different BNF QTLs respond differently to rhizobium inoculation, highlighting the importance of genetic background in experimental design .

How can researchers effectively analyze data from complex experiments involving nuoK2 function in diverse microbial communities?

Analysis of nuoK2 function within complex microbial communities requires sophisticated data integration strategies:

  • Statistical approaches:

    • Mixed-effects models to account for hierarchical data structures

    • PERMANOVA and ANOSIM for community composition differences

    • Co-occurrence network analysis to identify key interactions

  • Visualization techniques:

    • Constrained Principal Component Analysis (CPCoA) for visualization of treatment effects

    • Non-metric Multidimensional Scaling (NMDS) for community dissimilarity patterns

    • Heat maps for differential expression patterns

  • Integration methods:

    • Canonical Correspondence Analysis to correlate nuoK2 expression with community shifts

    • Structure Equation Modeling to test causal relationships

    • Random Forest Analysis to identify predictor variables

Research has demonstrated the effectiveness of these approaches in analyzing complex interactions in the rhizosphere. For example, CPCoA analysis successfully revealed that both soybean genotype and rhizobium inoculation significantly influenced fungal communities, explaining 39% of the variation (P = 0.003) . Similarly, Linear Discriminant Analysis Effect Size (LEfSE) effectively identified biomarker species associated with different treatment conditions.

What emerging technologies show promise for advancing research on nuoK2 and related respiratory chain components?

Several emerging technologies show exceptional promise for advancing nuoK2 research:

  • Single-molecule techniques:

    • Single-molecule FRET to track conformational changes during electron transfer

    • Patch-clamp techniques adapted for bacterial membranes to measure proton translocation

    • Nanopore-based approaches for studying membrane protein dynamics

  • Advanced imaging:

    • Super-resolution microscopy to visualize respiratory complex distribution in bacteroids

    • Correlative light and electron microscopy for structural-functional relationships

    • Live-cell imaging with genetically encoded sensors for redox state and membrane potential

  • Genomic and synthetic biology approaches:

    • CRISPR-Cas9 base editing for precise mutagenesis

    • Cell-free expression systems for high-throughput functional screening

    • Synthetic minimal respiratory chains to define essential components

  • Computational methods:

    • Quantum mechanics/molecular mechanics (QM/MM) simulations for electron transfer processes

    • Deep learning approaches for predicting protein-protein interactions

    • Genome-scale metabolic modeling integrated with respiratory chain function

These technologies would enable researchers to address fundamental questions about nuoK2 function that current methodologies cannot resolve. The integration of these approaches with established experimental systems would provide unprecedented insights into the role of respiratory chain components in symbiotic nitrogen fixation .

How might findings from nuoK2 research contribute to improving sustainable agricultural practices?

Research on nuoK2 and related respiratory chain components has significant potential to contribute to sustainable agricultural practices through several pathways:

  • Enhanced biological nitrogen fixation:

    • Development of rhizobial bioinoculants with optimized respiratory efficiency

    • Reduced dependency on synthetic nitrogen fertilizers

    • Lower environmental impacts from nitrate leaching and N2O emissions

  • Improved plant-microbe interactions:

    • Knowledge of respiratory chain adaptations can inform selection of compatible plant-microbe combinations

    • Understanding cross-kingdom interactions between bacteria and fungi for holistic rhizosphere management

    • Design of microbial consortia with complementary metabolic capabilities

  • Climate-resilient symbiotic systems:

    • Identification of respiratory variants adapted to environmental stressors

    • Development of symbiotic systems that maintain efficiency under changing conditions

    • Selection of plant genotypes with BNF QTLs that synergize with specific bacterial respiratory phenotypes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.