Recombinant Rhizobium sp. Nodulation protein E (nodE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
nodE; Nodulation protein E; Host-specificity of nodulation protein B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-402
Protein Length
full length protein
Species
Rhizobium sp. (strain N33)
Target Names
nodE
Target Protein Sequence
MDRRVVITGIGGLCGLGTDAPSIWKEMREGRSAIGPIVTSELHGLTGTIGAEIKTLPEHD IDRKQLVTMDRFSLLAVLAAREAMRQAGLSCDERNAYRFGAIVGVGGSGWEAIEASYRAL LLNGARRAGVMDVPKAMPSAAAGQVSMSLGLRGPVFGVTSACASANHAIASAVDQIRCGR ADVMLAGGSDAPFVFCVVKAWEAMRVIAPDTCRPFSSDRRGLVLGEGAGMAVLESYEHAT ARGATIIAEIAGIGLSADAFNLVSPAVEGPEAAMRACLADAGLNVQDVDYINAHGTGTKA NDRMETEAIKRVFGGHANSMSISSTKSMHAHCLGAASALEMIACVMAIQEGVVPPTANYR EPDPDCDLDVTPNVARERKVRVALSNAFAMAGMNAVLAFRQV
Uniprot No.

Target Background

Function
This protein is proposed to synthesize the fatty acyl chain of NOD factors. It is involved in the synthesis of a highly unsaturated fatty acid moiety, a crucial component of a lipo-oligosaccharide responsible for host specificity.
Protein Families
Beta-ketoacyl-ACP synthases family
Subcellular Location
Cell inner membrane.

Q&A

What are the primary functions of nodulation proteins in Rhizobium-legume symbiosis?

Nodulation proteins serve as critical signaling molecules in the establishment of symbiotic relationships between rhizobia and leguminous plants. They facilitate the formation of nitrogen-fixing root nodules through complex molecular dialogues with host plants. The primary functions include initiating root hair curling, infection thread formation, and eventual nodule organogenesis. Some rhizobial strains employ pathogenic-like effectors to hijack leguminous nodulation signaling pathways, demonstrating evolutionary adaptation of pathogenic mechanisms for mutualistic purposes . These proteins can suppress plant defense responses, modulate cytokinin-related genes that promote nodule development, and repress ethylene- and defense-related genes that might otherwise inhibit nodulation .

How do Type III Secretion Systems (T3SS) contribute to the rhizobium-legume symbiosis?

Type III Secretion Systems (T3SS) in rhizobia function similarly to those in pathogenic bacteria by delivering effector proteins directly into host plant cells. These systems are activated by plant-derived flavonoids during the early stages of symbiotic interaction. T3SS effectors can influence host range specificity by overcoming plant defense responses and promoting nodule development in compatible host plants. Research has shown that some T3SS effectors function not only during infection thread formation but also in mature nodules, indicating their roles in maintaining chronic infection . The presence of specific effectors can positively affect symbiosis with certain legume species while negatively impacting others, demonstrating their importance in determining host specificity .

What is the relationship between nodulation proteins and host defense responses?

Nodulation proteins, particularly those delivered via T3SS, play crucial roles in modulating host defense responses. During the establishment of symbiosis, legumes can mount defense reactions similar to those triggered by pathogens, including the production of reactive oxygen species (ROS) and antimicrobial compounds . Certain nodulation proteins act to suppress these defense responses, enabling successful colonization. For example, NopL of Rhizobium sp. strain NGR234 interferes with mitogen-activated protein kinase (MAPK) signaling, a key component of plant defense pathways . By suppressing defense responses, these proteins prevent premature nodule senescence and allow the symbiosis to develop fully, demonstrating the delicate balance between defense activation and suppression required for successful symbiotic relationships .

What are the recommended approaches for expressing and purifying recombinant nodulation proteins?

For successful expression and purification of recombinant nodulation proteins, a multi-step approach is recommended. Researchers commonly use heterologous expression systems, with E. coli being the most widely employed host for initial characterization. When expressing Rhizobium nodulation proteins, consider the following methodology:

  • Gene cloning into appropriate expression vectors containing affinity tags (His6, GST, or MBP) to facilitate purification

  • Expression optimization in E. coli strains (BL21(DE3), Rosetta, or Arctic Express) with varying induction temperatures (16-30°C) and IPTG concentrations (0.1-1.0 mM)

  • Solubility assessment using pilot expressions and SDS-PAGE analysis

  • Purification using affinity chromatography followed by size-exclusion chromatography for higher purity

For functional studies, expression in yeast systems can be particularly valuable, as demonstrated in studies with NopL where expression in yeast cells allowed for the investigation of its effects on MAPK signaling pathways and subsequent phosphorylation analysis . When studying post-translational modifications, eukaryotic expression systems may provide advantages over prokaryotic systems to ensure proper modification patterns.

How can researchers effectively evaluate the interaction between nodulation proteins and host plant receptors?

To effectively evaluate interactions between nodulation proteins and host plant receptors, researchers should employ a combination of in vitro and in planta approaches:

  • In vitro binding assays: Using surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or microscale thermophoresis (MST) to quantify binding affinities and kinetics between purified proteins

  • Yeast two-hybrid (Y2H) screening: For identifying potential interacting partners, as demonstrated in studies with rhizobial effectors

  • Bimolecular fluorescence complementation (BiFC): To visualize protein-protein interactions in plant cells

  • Co-immunoprecipitation (Co-IP): To confirm interactions in plant tissues

  • Adenylate cyclase fusion assays: This technique has been successfully used to demonstrate the translocation of effectors like NopE1, NopE2, and NopP into host cytoplasm by fusing the effector to Bordetella pertussis calmodulin-dependent adenylate cyclase, which becomes active only in eukaryotic cytoplasm where calmodulin is present

When studying the effect of nodulation proteins on signaling pathways, researchers have successfully used model systems like tobacco cells expressing specific MAP kinases together with the nodulation protein of interest, allowing observation of how the effector modulates defense signaling cascades .

What techniques are used to identify post-translational modifications of nodulation proteins?

Post-translational modifications (PTMs) play critical roles in the function of many nodulation proteins. The following techniques are recommended for comprehensive PTM analysis:

  • Mass spectrometry (MS): Liquid chromatography-tandem mass spectrometry (LC-MS/MS) is the gold standard for identifying specific PTM sites, as demonstrated in the identification of four phosphorylated serines in NopL

  • Phospho-specific antibodies: For detecting phosphorylation events on specific residues

  • Phos-tag SDS-PAGE: To separate and visualize phosphorylated protein forms

  • In vitro kinase assays: To determine which kinases can modify the nodulation protein

  • Site-directed mutagenesis: To create variants with modified PTM sites for functional validation

Research on NopL revealed that all four identified phosphorylation sites exhibit a Ser-Pro pattern, a typical motif in MAPK substrates, suggesting that NopL mimics MAPK substrates to interfere with plant defense signaling . Similar approaches can be applied to study other nodulation proteins and their potential modifications.

How do nodulation proteins contribute to host range specificity in rhizobium-legume symbioses?

Host range specificity in rhizobium-legume symbioses is determined by complex interactions, with nodulation proteins playing decisive roles at multiple stages. This specificity is not controlled by a single factor but is reinforced throughout the symbiotic process:

  • Initial recognition: Nodulation factors and their receptors provide the first layer of specificity

  • Infection process: Type III secretion system effectors can promote or hinder infection in specific hosts

  • Nodule development: Effectors influence organogenesis in a host-specific manner

  • Nitrogen fixation establishment: Some compatibility factors are required for proper bacteroid differentiation

Experimental evidence shows that specific effectors like NopE1 and NopE2 from B. japonicum positively affect symbiosis with Glycine max (soybean) and Macroptilium atropurpureum but negatively impact symbiosis with Vigna radiata (mung bean) . This host-specific effect demonstrates that the same effector can be beneficial or detrimental depending on the legume species. The complexity of this specificity explains why attempts to transfer signaling components between rhizobia or legumes have allowed infection or nodule formation between previously incompatible hosts but rarely result in effective nitrogen fixation .

What are the molecular mechanisms by which nodulation proteins suppress plant immune responses?

Nodulation proteins employ sophisticated mechanisms to suppress plant immune responses, allowing successful colonization. Current research indicates several key strategies:

  • MAPK pathway interference: Proteins like NopL act as competitive substrates for MAPKs, preventing phosphorylation of genuine targets involved in defense signaling. NopL was shown to be multiply phosphorylated at four serine residues with Ser-Pro motifs typical of MAPK substrates

  • Transcriptional reprogramming: Some effectors induce expression of cytokinin-related genes important for nodule organogenesis while repressing ethylene- and defense-related genes

  • ROS scavenging: Certain nodulation proteins may possess or induce antioxidant activities to neutralize the reactive oxygen species produced during defense responses

  • Prevention of programmed cell death: As demonstrated with NopL, which antagonizes nodule senescence by suppressing cell death mechanisms in Phaseolus vulgaris

Microscopic analysis of nodules induced by wild-type NGR234 versus a nopL mutant strain showed that the mutant induced more rapid formation of necrotic lesions, with infected cells displaying degraded symbiosome membranes and bacteroids - typical symptoms of premature nodule senescence . This evidence supports the critical role of these effectors in maintaining viable symbiotic relationships by actively suppressing host defense mechanisms.

How have pathogenic effector systems been adapted for mutualistic purposes in rhizobia?

The adaptation of pathogenic effector systems for mutualistic purposes in rhizobia represents a fascinating evolutionary development. Research has identified several key aspects of this adaptation:

  • Structural and functional homology: Some rhizobial effectors like Bel2-5 resemble pathogenic effectors such as XopD from Xanthomonas campestris, indicating evolutionary relationships

  • Customization for symbiosis: While maintaining core functions similar to pathogenic counterparts, rhizobial effectors have been modified to promote beneficial interactions rather than disease

  • Temporal regulation: Unlike in pathogens where effectors may be continuously deployed, rhizobial effector expression can be temporally regulated, with some active during infection and others persisting in mature nodules

  • Host-specific adaptations: The same core effector delivery system (T3SS) has been adapted to deliver different effector complements based on host compatibility requirements

The rhizobial effector Bel2-5 demonstrates this adaptation effectively, as it can induce nitrogen-fixing nodules even on soybean nfr mutants defective in Nod factor perception. Furthermore, introducing Bel2-5 into strains unable to nodulate soybean mutants affected in NF perception conferred nodulation ability, showing how these adapted effectors can bypass certain host requirements .

What are common challenges in working with recombinant nodulation proteins and how can they be addressed?

Researchers working with recombinant nodulation proteins face several challenges that can be addressed through specific strategies:

ChallengeCauseSolution
Low protein expressionCodon bias, protein toxicity, improper foldingUse codon-optimized genes, low temperature expression, fusion tags (MBP, SUMO)
Protein insolubilityHydrophobic regions, improper foldingSolubility tags, detergents for membrane proteins, refolding protocols
Loss of native functionMissing post-translational modificationsExpress in eukaryotic systems like yeast or plant cells
Protein instabilityProtease sensitivity, aggregationInclude protease inhibitors, optimize buffer conditions, add stabilizing agents
Weak or non-specific interactionsAssay sensitivity, buffer conditionsOptimize binding conditions, use more sensitive detection methods

When studying the effects of effectors on plant signaling, researchers have successfully used heterologous expression systems like yeast and tobacco cells. For instance, expression of nopL in Nicotiana tabacum was used to study its effects on MAPK signaling, demonstrating that appropriate expression systems can overcome many of these challenges .

How can researchers address conflicting results in host range specificity studies?

Conflicting results in host range specificity studies are common due to the complexity of rhizobium-legume interactions. To address these discrepancies, consider the following methodological approaches:

  • Standardize experimental conditions: Use consistent growth media, plant growth conditions, and inoculation methods across experiments

  • Control for genetic backgrounds: Ensure that both plant and rhizobial genotypes are well-characterized and consistent

  • Consider developmental timing: Assess symbiotic efficiency at multiple time points, as some effects may be temporal

  • Employ multiple assessment methods: Combine nodule counting, acetylene reduction assays, microscopy, and molecular analyses for comprehensive evaluation

  • Account for environmental factors: Soil conditions, temperature, and other environmental variables can significantly influence symbiotic outcomes

Studies have shown that the same effector can have opposite effects on different host plants. For example, NopE1 and NopE2 positively affect symbiosis with Glycine max and Macroptilium atropurpureum but negatively affect symbiosis with Vigna radiata . Such host-dependent effects highlight the importance of testing multiple host species under identical conditions when characterizing nodulation protein function.

What approaches can be used to study nodulation protein function when knockout mutants show no obvious phenotype?

When knockout mutants of nodulation proteins show no obvious phenotype, possibly due to functional redundancy or subtle effects, alternative approaches can reveal their functions:

  • Generate multiple gene knockouts: Create strains with mutations in functionally related genes to overcome redundancy

  • Use overexpression studies: Express the protein at higher-than-normal levels to potentially amplify subtle effects

  • Employ heterologous expression: Express the protein in non-native hosts (e.g., in yeast or plant cells) to study specific biochemical functions

  • Conduct detailed transcriptomic analyses: Compare wild-type and mutant strains under various conditions to detect subtle changes in gene expression patterns

  • Examine competition assays: Test the ability of mutants to compete with wild-type strains for nodulation, which can reveal subtle fitness effects

  • Analyze temporal dynamics: Perform detailed time-course experiments, as some phenotypes may be transient

  • Study under stress conditions: Examine mutant performance under various stresses, as some functions may only be important under specific conditions

The study of NopL demonstrates the value of these approaches, as expression in both yeast and tobacco cells revealed its function in MAPK signaling inhibition, which might not have been evident from nodulation tests alone .

What emerging technologies could advance our understanding of nodulation protein mechanisms?

Several emerging technologies hold promise for deepening our understanding of nodulation protein mechanisms:

  • CRISPR-Cas9 genome editing: For precise modification of both rhizobial and plant genomes to study protein function in native contexts

  • Single-cell transcriptomics: To understand cell-specific responses to nodulation proteins within heterogeneous nodule tissues

  • Advanced imaging techniques: Including super-resolution microscopy and light sheet microscopy to visualize protein localization and dynamics in living tissues

  • Cryo-electron microscopy: For high-resolution structural analysis of nodulation proteins and their complexes

  • Proximity labeling methods: Such as BioID or APEX to identify protein interaction networks in planta

  • Optogenetics and chemically-induced dimerization: To control protein activity with temporal and spatial precision

These technologies could help resolve outstanding questions about the precise mechanisms by which effectors like Bel2-5 induce nodulation signaling or how NopL interferes with MAPK pathways in real-time within living plant cells .

How might understanding nodulation protein functions contribute to engineering improved symbiotic relationships?

Understanding nodulation protein functions could significantly contribute to engineering improved symbiotic relationships through several applications:

  • Expanding host range: By introducing or modifying specific effectors that overcome host incompatibility barriers

  • Enhancing nitrogen fixation efficiency: Through modification of proteins that influence bacteroid differentiation or nodule metabolism

  • Improving stress tolerance: By engineering effectors that better suppress defense responses under environmental stress conditions

  • Creating synthetic symbioses: Potentially transferring nodulation capabilities to non-legume crops by introducing minimal sets of compatible signaling components

Current research shows that host range is not simply based on compatibility in molecular dialogue pre-infection but is reinforced at multiple steps throughout symbiosis . Attempts to transfer signaling components between rhizobia or legumes have allowed infection or nodule formation between previously incompatible hosts, but rarely result in nitrogen fixation, suggesting that complete understanding of compatibility determinants at all stages is necessary to optimize engineered symbioses .

What are the ecological implications of variation in nodulation protein repertoires among rhizobial strains?

The variation in nodulation protein repertoires among rhizobial strains has significant ecological implications:

  • Niche specialization: Different effector sets allow rhizobial strains to specialize on particular host plants in specific environments

  • Community dynamics: Variation influences competition between rhizobial strains for nodulation of compatible hosts

  • Evolutionary arms races: Ongoing co-evolution between hosts and symbionts may drive diversification of both nodulation proteins and host receptors

  • Resilience to environmental change: Diversity in nodulation strategies at the community level may provide resilience against changing environmental conditions

  • Geographical distribution patterns: Different nodulation protein repertoires may contribute to the biogeographical distribution of rhizobial strains

Research indicates that legume plants have developed mechanisms to permit symbiosis only with rhizobial strains that fix nitrogen efficiently, preventing cheating by ineffective strains . This selectivity is enforced at all stages of symbiosis, with partner choice beginning during initial communication and continuing even once nitrogen-fixing nodules have developed, highlighting the ecological importance of these specialized protein repertoires in maintaining mutualistic relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.