Recombinant Rhizobium sp. Nodulation protein nolT (nolT)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
nolT; NGR_a00670; y4yF; Nodulation protein NolT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
34-289
Protein Length
Full Length of Mature Protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
nolT
Target Protein Sequence
CKVDLYTQLQEREANEMLALLMDSGVDAVRVAGKDGTSTIQVDEKLLAFSIKLLNAKGLP RQSFKNLGEIFQGSGLIASPTEERARYVYALSEELSHTISDIDGVFSARVHVVLPHNDLL RAGDTPSSASVFIRHDAKTNLPALLPKIKMLVAESIEGLAYDKVEVVLVPVERSAQEQRS LLATDLAQASRPIPEPLLAVAVGVSAAVFAVTCYLLFIVLGHRRRQLTGELSRVQERPGV SALAAIRKKIPGLGRR
Uniprot No.

Target Background

Database Links
Protein Families
YscJ lipoprotein family
Subcellular Location
Cell outer membrane; Lipid-anchor.

Q&A

What is the Rhizobium sp. Nodulation protein NolT and what is its role in symbiosis?

NolT is a membrane protein involved in host-specific nodulation in Rhizobium species. It is encoded by the nolT gene, which is part of a cluster that includes nolBTU, ORF4, nolV, nolW, and nolX. These genes play critical roles in determining host range and specificity in legume-Rhizobium symbiosis .

The predicted NolT protein contains putative membrane-spanning regions, suggesting it functions as a membrane component. While its exact biochemical function remains under investigation, genetic studies have demonstrated that NolT is associated with the type III secretion system (T3SS) in Rhizobium, which delivers effector proteins into host cells .

Importantly, inactivation of nolT extends the host range of certain Rhizobium strains. For example, when nolT is mutated in Rhizobium fredii strain USDA257, the bacteria gain the ability to nodulate agronomically improved soybean cultivars like McCall, which the wild-type strain cannot nodulate .

How is nolT expression regulated during symbiosis?

Expression of nolT and related genes (nolBTU and nolX) is induced by plant flavonoid signal molecules, with expression increasing as much as 30-fold in response to these compounds. This induction occurs despite these genes lacking typical nod-box promoters that are found in many other nodulation genes .

Histochemical staining of soybean roots using nolT-lacZ fusions has verified that this gene is expressed continuously from preinfection through the development of functional nodules. This temporal expression pattern indicates sustained roles throughout the symbiotic process .

Table 1: Expression pattern of nolT compared to other related genes

GeneInduction by flavonoidsExpression timingDependency on NodDLocation
nolTUp to 30-fold increaseContinuous from preinfection to mature noduleYesMembrane-associated
nolBUp to 30-fold increaseContinuous from preinfection to mature noduleYesAssociated with T3SS
nolXUp to 30-fold increaseContinuous from preinfection to mature noduleYesT3SS component
nodZPresent but varies by strainEarly infection eventsYesCytoplasmic

What is the genomic context of the nolT gene in Rhizobium sp.?

In Rhizobium strains, nolT is typically located in a gene cluster that includes several other nodulation genes. In Rhizobium fredii strain USDA257, nolT is part of a 5596 bp DNA sequence containing seven open reading frames: nolB, nolT, nolU, ORF4, nolV, nolW, and nolX .

Five of these genes (nolBTU, ORF4, and nolV) are closely spaced and share the same polarity, while nolW and nolX are of the opposite polarity. The initiation codon for nolW lies 155 bp upstream from that of nolB, and is separated from nolX by 281 bp .

In Rhizobium sp. strain NGR234, the genome consists of three replicons: the symbiotic plasmid pNGR234a (536,165 bp), the megaplasmid pNGR234b (>2,000 kb), and the chromosome (>3,700 kb). Nodulation genes, including those involved in the type III secretion system, are typically located on the symbiotic plasmid .

What methodologies are recommended for functional characterization of NolT?

To characterize NolT function, researchers should consider a multi-faceted approach:

Site-Directed Mutagenesis:

  • Create mutations in conserved domains of nolT using mudII1734 or similar transposons

  • Target putative membrane-spanning regions to assess their importance for protein function

  • Evaluate the phenotypic effects of these mutations on nodulation of different host plants

Expression Analysis:

  • Construct nolT-lacZ fusions to monitor gene expression under different conditions

  • Use histochemical staining to visualize spatial and temporal expression patterns in planta

  • Quantify expression levels using quantitative RT-PCR after exposure to different plant flavonoids

Protein Interaction Studies:

  • Employ bimolecular fluorescence complementation (BiFC) to identify protein interactions in planta

  • Use co-immunoprecipitation to isolate protein complexes containing NolT

  • Apply proximity-dependent biotin identification (BioID) to map the protein interaction network

Recombinant Protein Production:

  • Express NolT in E. coli or other heterologous systems using vectors like pKK223-3

  • Include appropriate affinity tags to facilitate purification

  • Optimize expression conditions to maximize protein yield and proper folding

How does mutation of nolT affect host specificity in Rhizobium-legume symbiosis?

Mutation of nolT significantly alters host range specificity in Rhizobium-legume interactions. Site-directed mutagenesis with mudII1734 has confirmed that inactivation of nolT (as well as nolB, nolU, nolV, nolW, or nolX) extends host range for nodulation to include McCall soybean, which is typically resistant to nodulation by wild-type Rhizobium fredii strain USDA257 .

This altered phenotype appears to be genetically linked to sensitivity to competitive nodulation blocking, a phenomenon where the mutant's ability to nodulate McCall is inhibited by the presence of the wild-type strain .

These findings suggest a regulatory mechanism where NolT and related proteins may act as negative regulators of nodulation in certain host backgrounds, rather than essential factors for nodulation. This negative regulation might involve interactions with host defense responses or competition for binding sites on host roots.

Table 2: Effects of nolT mutation on host specificity

Host PlantWild-type NodulationnolT Mutant NodulationEffect on Nodule Development
Primitive soybean cv. PekingEffectiveEffectiveNo significant change
Improved soybean cv. McCallNo nodulationEffectiveGain of function
Other legumes (varies by strain)Strain-dependentExtended rangeMay vary from positive to negative

What role does NolT play in the type III secretion system of Rhizobium sp.?

The type III secretion system (T3SS) in rhizobia functions similarly to that in pathogenic bacteria, delivering effector proteins directly into host cells. Recent evidence suggests that rhizobia have adapted this system, typically associated with pathogenesis, to promote symbiotic interactions .

NolT appears to be a component of this specialized secretion apparatus. Its membrane-spanning regions suggest it may form part of the structural conduit through which effector proteins pass. Given its location in a gene cluster with other T3SS components, NolT likely contributes to the assembly or regulation of this secretion machinery .

The T3SS of Rhizobium sp. strain NGR234 has been shown to secrete proteins called Nodulation outer proteins (Nops). Some of these Nops, like NopM, function as E3 ubiquitin ligases in planta and can influence nodulation either positively or negatively depending on the host plant .

While NolT itself is not secreted, it participates in the secretion process of these effectors. The host-range extension observed in nolT mutants may result from the inability to secrete specific effector proteins that would otherwise trigger defense responses in certain host plants, like improved soybean cultivars .

How can recombinant NolT be expressed and purified for structural and functional studies?

Expression System Selection:
For recombinant NolT expression, researchers should consider:

  • E. coli expression systems using vectors such as pKK223-3, which places the gene under control of the strong tac promoter

  • Alternative hosts like Rhizobium itself for more authentic post-translational modifications

  • Cell-free protein synthesis systems for difficult-to-express membrane proteins

Optimization Protocol:

  • Clone the nolT gene with appropriate restriction sites (e.g., EcoRI and HindIII)

  • Transform into expression hosts like E. coli XL1-Blue MRF'

  • Induce expression with IPTG (typically 0.1-1.0 mM)

  • Test expression at different temperatures (16-37°C) to optimize folding

  • Consider adding membrane-solubilizing detergents during extraction

Purification Strategy:

  • Solubilize membrane fractions using mild detergents (DDM, LDAO, or OG)

  • Employ affinity chromatography using engineered tags (His, GST, or MBP)

  • Further purify using ion exchange and size exclusion chromatography

  • Verify protein identity using Western blotting and mass spectrometry

  • Assess protein quality using circular dichroism and thermal stability assays

For structural studies, the purified protein can be analyzed using X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy, depending on the research question and available facilities.

What experimental systems best model NolT function in host-microbe interactions?

In Vitro Systems:

  • Liposome reconstitution assays to study membrane insertion and topology

  • Proteoliposomes incorporating purified NolT to assess transport function

  • Bacterial membrane vesicles containing NolT to study protein-protein interactions

Plant-Based Systems:

  • Hairy root transformation of legumes to study NolT effects in planta

  • Expression of NolT in heterologous plant systems like tobacco to observe plant cell responses

  • Split-root systems to study local and systemic effects of NolT-containing bacteria

Comparative Studies:
Compare NolT function across different Rhizobium species and strains to identify conserved functional domains. For instance, the nolU-ORF4-nolV clone hybridizes to a single 8.0 kb EcoRI fragment from 10 strains of R. fredii and broad-host-range Rhizobium sp. NGR234, but hybridizing sequences are not detectable in other rhizobia .

Advanced Imaging:
Employ fluorescently tagged NolT variants combined with super-resolution microscopy to visualize protein localization and dynamics during the infection process.

How do genetic rearrangements in Rhizobium sp. affect nolT function and nodulation efficiency?

Rhizobium genomes are dynamic structures prone to mutation and genomic rearrangements. In Rhizobium sp. strain NGR234, large-scale DNA rearrangements consisting of cointegrations and excisions between the three replicons have been observed .

These rearrangements can potentially affect nolT function by:

  • Altering gene dosage if nolT is duplicated or deleted

  • Creating novel regulatory contexts if nolT is relocated

  • Forming new fusion proteins if rearrangements occur within coding sequences

Experimental evidence suggests that cointegration and excision events often proceed via a Campbell-type mechanism, mediated by insertion sequence elements. Surprisingly, changes in genome architecture do not necessarily alter growth and symbiotic proficiency of Rhizobium derivatives .

Researchers can study these processes using:

  • PCR-based strategies to detect specific rearrangements

  • Artificial selection of rearranged subpopulations

  • Long-read sequencing technologies to characterize structural variants

  • Experimental evolution under different selective pressures

What mass spectrometry approaches are useful for studying NolT and its interactions?

Mass spectrometry (MS) provides powerful tools for analyzing NolT structure, modifications, and interactions:

Protein Identification and Characterization:

  • Use LC-MS/MS to confirm the identity of purified recombinant NolT

  • Apply top-down proteomics to analyze intact NolT and identify post-translational modifications

  • Employ hydrogen-deuterium exchange MS to study protein dynamics and conformational changes

Interaction Analysis:

  • Cross-linking MS (XL-MS) to map protein-protein interaction interfaces

  • Affinity purification-MS to identify NolT-associated protein complexes

  • Proximity labeling approaches (BioID-MS, APEX-MS) to identify proximal proteins in native conditions

Membrane Protein Analysis:

  • Native MS with specialized detergents or nanodiscs to maintain membrane protein structure

  • Lipid-protein interaction analysis using lipidomics approaches

  • Integration with structural biology techniques for comprehensive characterization

How does NolT compare to other bacterial type III secretion system components?

NolT shares functional and structural similarities with components of T3SSs in both symbiotic and pathogenic bacteria:

Structural Homology:
The membrane-spanning regions of NolT resemble those of other T3SS components, suggesting conserved structural features necessary for membrane insertion and channel formation .

Functional Comparison:
While T3SSs in pathogens like Xanthomonas campestris deliver effectors that suppress host immunity to facilitate infection, rhizobial T3SSs appear to have adapted this machinery to modulate host responses for symbiotic purposes .

Table 3: Comparison of NolT with related T3SS proteins

ProteinOrganismFunctionSimilarity to NolTHost Response
NolTRhizobium frediiT3SS component-Modulation of symbiosis
YscTYersinia spp.Inner membrane T3SS componentStructural homologyPathogenesis
SpaRSalmonella spp.Export apparatus proteinFunctional similarityPathogenesis
HrcTXanthomonas campestrisT3SS componentPartial homologyPlant defense elicitation

The evolutionary relationship between symbiotic and pathogenic T3SSs suggests that rhizobia have repurposed this secretion system for mutualistic interactions, with NolT representing a key adaptation in this process .

What computational approaches aid in predicting NolT structure and function?

Structure Prediction:

  • Apply AlphaFold2 or RoseTTAFold to generate accurate 3D models of NolT

  • Use transmembrane topology prediction tools (TMHMM, TOPCONS) to identify membrane-spanning regions

  • Employ molecular dynamics simulations to study membrane insertion and stability

Functional Annotation:

  • Perform hidden Markov model searches against specialized databases

  • Use co-evolution analysis to identify functionally linked residues

  • Apply gene neighborhood analysis to predict functional associations

Evolutionary Analysis:

  • Conduct phylogenetic analyses to trace the evolutionary history of nolT

  • Compare selection pressures across different Rhizobium lineages

  • Identify horizontal gene transfer events that may have shaped nolT evolution

These computational approaches, combined with experimental validation, provide powerful tools for understanding NolT function and its role in symbiosis.

How might understanding NolT function advance agricultural applications?

Research on NolT and related proteins has significant implications for sustainable agriculture:

Enhanced Biological Nitrogen Fixation:
Understanding how NolT affects host specificity could lead to engineered Rhizobium strains with broader host ranges, potentially extending nitrogen fixation benefits to additional crop species .

Improved Inoculant Development:
Knowledge of how NolT functions in the T3SS could inform the development of more effective rhizobial inoculants, optimized for specific crop varieties and environmental conditions .

Plant Breeding Applications:
Understanding plant responses to NolT and other T3SS components could guide breeding efforts to develop legume varieties with enhanced symbiotic capacity .

Sustainable Agriculture:
Optimizing rhizobium-legume symbiosis through manipulation of NolT and related proteins could reduce dependency on chemical fertilizers, leading to more sustainable agricultural practices .

What are the key unresolved questions regarding NolT function?

Despite significant advances, several critical questions about NolT remain unanswered:

  • What is the exact molecular mechanism by which NolT contributes to T3SS assembly or function?

  • How does NolT interact with other T3SS components and the bacterial membrane?

  • What specific signals regulate nolT expression beyond the known flavonoid induction?

  • How has NolT evolved across different Rhizobium lineages, and what does this reveal about host adaptation?

  • Can NolT function be modulated to optimize symbiotic outcomes in agricultural settings?

Future research addressing these questions will require integrated approaches combining structural biology, genetics, biochemistry, and systems biology to fully elucidate NolT's role in the complex process of rhizobium-legume symbiosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.