Recombinant Rhizobium sp. Probable ABC transporter permease protein y4oQ (NGR_a02190)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The protein is primarily expressed in E. coli due to high yield and rapid turnaround, though alternative systems (yeast, insect, or mammalian cells) are used for post-translational modifications (PTMs) to ensure proper folding or activity .

Host SystemAdvantagesConsiderations
E. coliHigh yield, cost-effective, rapid productionLimited PTMs, requires refolding
YeastEnhanced PTMs (e.g., glycosylation)Longer production time
Insect/MammalianNative-like folding and activityHigher cost, complex protocols

Purification involves affinity chromatography (His-tag) and SDS-PAGE validation .

Functional Roles

NGR_a02190 is part of the binding-protein-dependent transport system y4oPQRS, likely responsible for translocating sugar-like substrates across bacterial membranes . Its role includes:

  • Substrate Recognition: Interacts with extracellular binding proteins to identify specific substrates.

  • Membrane Translocation: Facilitates substrate movement through the inner membrane via ATP-dependent mechanisms.

This system is critical for nutrient uptake in symbiotic or free-living Rhizobium species .

Research Applications

ApplicationDetailsSource
Structural StudiesX-ray crystallography or cryo-EM to resolve permease-substrate interactions
Transport Mechanism AnalysisKinetic assays to study substrate specificity and ATP hydrolysis rates
ELISA DevelopmentDetects y4oQ in biological samples; available in 50 µg quantities
Symbiotic Interaction StudiesInvestigates role in plant-bacteria interactions during nitrogen fixation

Comparative Analysis of Recombinant Preparations

FeatureE. coli ExpressionYeast/Insect/Mammalian Expression
YieldHighModerate-Low
PTMsAbsentPresent (e.g., glycosylation)
ActivityRequires refolding for functional assaysNative activity
CostLowHigh

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
NGR_a02190; y4oQ; Probable ABC transporter permease protein y4oQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02190
Target Protein Sequence
MTISQTVPRGAVAVRRRRRIRISTVVWFTMPAAAIMLLVLGVPLVYSFYYSLTGWSLVVP GSDQDFIGLLNYTDVLRSSEFWAAIRVTLIYAVVAVSLECALGILFAVLLNLEFFGRGLF RSLMLIPMVITPAVVGIFWKLLYEQDSGVFNYLLGTLGFEPVPWLSLTVALASVIIVDVW QSTPFFTLIILAGLQSLDRDTVSAAQADGANALQVFRYLTLPHLVPYIMIAAAFRIIGVM ADFDKIFLLTLGGPGNVTTTLSVYAYNTGFKVFDIGRTTAISWIYVVFVLAISAPLIWRL FRGASVNRH
Uniprot No.

Target Background

Function
Likely a component of the binding-protein-dependent transport system y4oPQRS. This system likely transports a sugar-like molecule and is responsible for substrate translocation across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, MalFG subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does y4oQ fit into the broader ABC transporter family?

The y4oQ protein belongs to the ATP-binding cassette (ABC) transporter superfamily, which constitutes one of the largest families of membrane proteins in most organisms. In humans and bacteria alike, ABC transporters serve diverse functions and underpin numerous key physiological processes . The specific y4oQ protein functions as a permease component, which forms the transmembrane domain of the transporter complex.

ABC transporters typically consist of two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and two transmembrane domains (TMDs) that form the substrate translocation pathway. The y4oQ protein likely represents one of these TMDs in the complete transporter complex. These transporters can be configured as full transporters (containing all domains in a single polypeptide) or half transporters (containing one NBD and one TMD that dimerize to form functional units) . Understanding this context helps researchers place the y4oQ protein within the broader framework of membrane transport systems in Rhizobium species.

What physiological roles do ABC transporters like y4oQ play in Rhizobium species?

ABC transporters in Rhizobium species serve several critical physiological functions that contribute to their survival and symbiotic relationships with plants. Based on genomic analyses of related Rhizobium strains, these transporters are involved in:

  • Nutrient acquisition: They transport essential nutrients including carbohydrates, amino acids, peptides, and ions across the bacterial membrane.

  • Symbiotic interactions: They play crucial roles in establishing and maintaining symbiotic relationships with host plants, including the transport of signaling molecules.

  • Substance export: They can function in the export of compounds produced by the bacteria, including metabolites and potentially symbiotic factors.

  • Stress response: They help bacteria adapt to changing environmental conditions by facilitating transport of osmoprotectants and other protective compounds .

In the specific case of Rhizobium-legume symbiosis, ABC transporters like y4oQ might be involved in the transport of substances essential for nodulation and nitrogen fixation. For instance, research on Rhizobium leguminosarum has shown that certain ABC transporters affect competition for nodulation and are involved in glycerol utilization . These findings suggest that y4oQ might play a role in nutrient acquisition during the symbiotic process, though specific functional characterization of this particular protein requires further investigation.

What are the optimal conditions for heterologous expression of Recombinant y4oQ?

The heterologous expression of Recombinant y4oQ requires careful optimization to achieve high yields of functional protein. Based on successful protocols for similar membrane proteins, the following approach is recommended:

Expression System Selection:
E. coli is the most commonly used expression system for Recombinant y4oQ, as evidenced by its successful application in producing this protein with N-terminal His tags . Several E. coli strains can be tested to identify optimal expression, with BL21(DE3) and its derivatives often yielding good results for membrane proteins.

Expression Conditions Table:

ParameterRecommended ConditionsRationale
Temperature16-25°CLower temperatures reduce inclusion body formation for membrane proteins
Inducer Concentration0.1-0.5 mM IPTGModerate inducer levels prevent overwhelming the membrane insertion machinery
Growth PhaseMid-log phase (OD600 of 0.6-0.8)Optimal cell density for induction
Duration16-20 hoursExtended expression time at lower temperatures
MediaEnriched media (e.g., TB, 2YT)Provides nutrients for extended expression periods

Important Considerations:

  • Membrane proteins like y4oQ often require specialized approaches to prevent toxicity and misfolding.

  • The addition of specific membrane-stabilizing compounds (glycerol 5-10%) in the culture medium can improve yields.

  • Codon optimization for E. coli expression may be necessary when significant codon bias exists between Rhizobium and E. coli .

This methodological approach has been successfully applied to other ABC transporter components and should provide a solid starting point for y4oQ expression studies.

What purification strategies are most effective for obtaining high-quality y4oQ protein?

Purifying membrane proteins like y4oQ presents significant challenges that require specialized approaches. Based on successful purification of similar ABC transporter components, the following multi-step purification strategy is recommended:

1. Membrane Isolation and Solubilization:

  • Harvest cells and disrupt by sonication or high-pressure homogenization in buffer containing protease inhibitors

  • Isolate membrane fraction through differential centrifugation (typically 100,000 × g ultracentrifugation)

  • Solubilize membranes using appropriate detergents (initial screening recommended among DDM, LMNG, and UDM)

2. Affinity Chromatography:

  • Utilize the N-terminal His-tag for IMAC (Immobilized Metal Affinity Chromatography)

  • A typical buffer composition would include 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and detergent at 2-3× CMC

  • Elute with imidazole gradient (typically 20-300 mM)

3. Size Exclusion Chromatography:

  • Further purify using SEC to separate aggregates and obtain monodisperse protein

  • Buffer typically contains reduced detergent concentration (1-1.5× CMC)

Detergent Screening Table:

DetergentPropertiesRecommended ConcentrationNotes
DDM (n-Dodecyl-β-D-maltoside)Mild, non-ionic1% for solubilization, 0.05% for purificationMost commonly successful for ABC transporters
LMNG (Lauryl Maltose Neopentyl Glycol)Mild, synthetic1% for solubilization, 0.01% for purificationBetter stability for some membrane proteins
UDM (n-Undecyl-β-D-maltoside)Mild, non-ionic1% for solubilization, 0.05% for purificationAlternative if DDM is not optimal

Quality Control:
After purification, protein quality should be assessed through SDS-PAGE, Western blotting, and analytical SEC. For functional studies, it's crucial to verify that the protein remains properly folded, which can be assessed through techniques such as circular dichroism or limited proteolysis . The final purified product should be maintained in the presence of detergent above its critical micelle concentration to prevent aggregation.

How can researchers overcome challenges in obtaining functional recombinant ABC transporters?

Obtaining functional recombinant ABC transporters presents several specific challenges that researchers should address through systematic optimization:

Challenge 1: Membrane Protein Toxicity

  • Implement tight expression control using repressible promoters

  • Consider using C41/C43 E. coli strains specifically developed for toxic membrane proteins

  • Test expression in cell-free systems for highly toxic proteins

Challenge 2: Improper Membrane Insertion

  • Co-express with chaperones (GroEL/GroES system)

  • Test fusion partners that can direct proper membrane insertion

  • Consider lower expression temperatures (16°C) to allow proper folding

Challenge 3: Maintaining Functionality During Purification

  • Include lipids during purification (0.01-0.1 mg/ml of E. coli lipid extract)

  • Maintain physiologically relevant ion concentrations (particularly Mg²⁺)

  • Consider nanodiscs or liposome reconstitution for functional studies

Innovative Approaches:
Researchers have successfully employed several innovative techniques to overcome these challenges. For example, studies with MsbA and P-gp (bacterial and human ABC transporters) demonstrated that cysteine-reactive fluorescent reagents can be used to investigate the catalytic cycle in relation to crystal structures . This approach allows monitoring of conformational changes during substrate transport.

Additionally, reconstitution into nanodiscs or liposomes after purification has proven effective for functional studies of ABC transporters. These lipid environments more closely mimic the native membrane and can help preserve protein activity. For y4oQ specifically, reconstitution experiments could reveal important insights about its substrate specificity and transport mechanism.

How can the substrate specificity of y4oQ be experimentally determined?

Determining the substrate specificity of ABC transporters like y4oQ requires a multi-faceted approach combining in vitro and in vivo methodologies:

In Vitro Transport Assays:

  • Liposome Reconstitution: Purified y4oQ should be reconstituted into proteoliposomes along with the complete ABC transporter complex components.

  • Substrate Screening: Candidate substrates can be tested using:

    • Radiolabeled substrate uptake/efflux assays

    • Fluorescent substrate analogs monitored by spectrofluorometry

    • Mass spectrometry-based detection of substrate transport

In Vivo Approaches:

  • Genetic Complementation: Express y4oQ in Rhizobium mutants lacking the transporter to determine which growth phenotypes are restored.

  • Substrate-Induced Gene Expression: Monitor expression changes of the y4oQ operon in response to different potential substrates.

  • Growth Phenotyping: Assess growth capabilities on different carbon sources, similar to studies with Rhizobium leguminosarum that identified glycerol utilization linked to ABC transporters .

Computational Predictions:
Integrate experimental approaches with bioinformatic analyses:

  • Sequence homology with characterized transporters

  • Structural modeling to identify substrate binding pockets

  • Genomic context analysis to identify potential metabolic connections

Based on the genomic analysis of related Rhizobium species, potential substrates may include carbohydrates, amino acids, or signaling molecules involved in plant-microbe interactions . The specific role of y4oQ in Rhizobium-legume symbiosis suggests it might transport compounds essential for nodulation or nitrogen fixation processes.

What methods are effective for studying the role of y4oQ in Rhizobium-plant symbiosis?

Investigating the role of y4oQ in Rhizobium-plant symbiosis requires an integrated approach spanning molecular genetics, biochemistry, and plant biology:

Genetic Manipulation Strategies:

  • Gene Knockout/Knockdown: Create y4oQ deletion mutants in Rhizobium sp. using CRISPR-Cas9 or homologous recombination.

  • Complementation Analysis: Reintroduce wild-type or modified y4oQ genes to confirm phenotypes.

  • Reporter Gene Fusions: Construct transcriptional/translational fusions to monitor y4oQ expression during symbiosis.

Symbiosis Phenotyping:

  • Nodulation Assays: Compare nodule number, size, and timing between wild-type and mutant strains.

  • Nitrogen Fixation: Measure nitrogenase activity using acetylene reduction assays.

  • Competitive Nodulation: Perform mixed inoculation experiments to assess the competitive ability of y4oQ mutants, similar to studies showing ABC transporters affect competition for nodulation .

Molecular Analysis:

  • Transcriptomics: RNA-seq analysis of both bacterial and plant gene expression during symbiosis.

  • Metabolomics: Profile metabolite changes in nodules formed by wild-type versus y4oQ mutants.

  • Protein Localization: Use fluorescent protein fusions to track y4oQ localization during infection and nodule development.

Experimental Design Table:

Experimental ApproachMeasurementsExpected Outcomes
Nodulation KineticsNumber and timing of nodule formationDetermines if y4oQ affects early symbiotic interactions
Nitrogenase ActivityAcetylene reduction, 15N incorporationQuantifies nitrogen fixation efficiency
Competition AssaysRatio of mutant vs. wild-type bacteria in nodulesAssesses symbiotic fitness contributions
Metabolite ProfilingConcentration of carbon compounds, signalsIdentifies transported substrates in symbiotic context

By combining these approaches, researchers can establish whether y4oQ plays a critical role in symbiotic interactions, potentially in transporting carbon sources like glycerol that influence competitive fitness during nodulation, as seen in related systems .

How can researchers investigate the regulatory mechanisms controlling y4oQ expression?

Understanding the regulatory mechanisms controlling y4oQ expression requires investigation at multiple levels, from transcriptional control to post-translational regulation:

Transcriptional Regulation Analysis:

  • Promoter Mapping: Identify the transcriptional start site using 5' RACE and define the promoter region.

  • Promoter-Reporter Fusions: Create transcriptional fusions with reporter genes (GFP, LacZ) to monitor expression under different conditions.

  • Transcription Factor Identification: Employ techniques such as:

    • Electrophoretic Mobility Shift Assays (EMSA) with cell extracts

    • DNA-affinity chromatography followed by mass spectrometry

    • Bacterial one-hybrid screens to identify interacting regulators

Condition-Dependent Expression:

  • Systematic Testing: Evaluate y4oQ expression under various conditions including:

    • Different carbon and nitrogen sources

    • Root exudate exposure

    • Symbiotic versus free-living states

    • Stress conditions (pH, oxidative stress, nutrient limitation)

  • High-Throughput Approaches: RNA-seq or microarray analysis across multiple conditions to identify co-regulated genes and regulatory networks.

Post-Transcriptional Regulation:

  • mRNA Stability: Measure transcript half-life using transcription inhibition followed by qRT-PCR.

  • Small RNA Interaction: Identify potential regulatory sRNAs using computational prediction and validation.

Post-Translational Regulation:

  • Phosphorylation Analysis: Use phosphoproteomic approaches to identify potential regulatory phosphorylation sites.

  • Protein-Protein Interactions: Employ bacterial two-hybrid or co-immunoprecipitation to identify interacting regulatory proteins.

Based on studies of other ABC transporters in Rhizobium, regulatory mechanisms might involve specific transcriptional regulators like GlpR (a DeoR regulator) that has been shown to regulate glycerol utilization genes in R. leguminosarum . Additionally, the genomic context analysis of Rhizobium species reveals complex regulatory networks involving quorum sensing systems that might influence transporter expression during symbiotic interactions .

What are the most effective approaches for determining the three-dimensional structure of y4oQ?

Determining the three-dimensional structure of membrane proteins like y4oQ presents unique challenges requiring specialized approaches. The following methodologies have proven effective for ABC transporter structural analysis:

X-ray Crystallography:
Despite challenges, crystallography remains powerful for membrane proteins. Key considerations include:

  • Detergent Screening: Systematic testing of detergents is crucial for crystal formation (DDM, LMNG, UDM recommended as starting points).

  • Lipidic Cubic Phase (LCP): This method has revolutionized membrane protein crystallography and should be attempted if traditional approaches fail.

  • Protein Engineering: Consider:

    • Thermostabilizing mutations

    • Removal of flexible regions

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

  • Ortholog Screening: Test y4oQ orthologs from different Rhizobium species, as protein stability and crystallizability can vary significantly between homologs .

Cryo-Electron Microscopy:
Recent advances make Cryo-EM increasingly viable for membrane proteins:

  • Sample Preparation: Reconstitution in nanodiscs or amphipols often yields better results than detergent micelles.

  • Classification Approaches: Extensive 2D and 3D classification to separate conformational states.

  • Resolution Enhancement: Use of Volta phase plates and energy filters can improve resolution for smaller membrane proteins.

Complementary Approaches:

  • NMR Spectroscopy: While challenging for full-length transporters, NMR can provide valuable information about specific domains or conformational dynamics.

  • EPR Spectroscopy: Site-directed spin labeling combined with EPR spectroscopy can provide distance measurements and accessibility information, particularly useful for tracking conformational changes .

  • X-ray Radiolytic Footprinting with Mass Spectrometry (XF-MS): While not yet widely applied to ABC transporters, this technique offers valuable insights into dynamics and can identify structural waters and conformational changes .

Structural Prediction:
With improvements in computational methods, AlphaFold2 and RoseTTAFold can provide valuable initial structural models that can guide experimental designs even before experimental structures are obtained.

How can molecular dynamics simulations enhance our understanding of y4oQ function?

Molecular dynamics (MD) simulations represent a powerful computational approach to investigate the conformational dynamics and mechanistic details of membrane proteins like y4oQ. Here's how researchers can effectively apply MD to study this ABC transporter component:

Simulation Setup and Parameters:

  • System Preparation:

    • Embed the protein in a lipid bilayer that mimics bacterial membranes (POPE/POPG mixture recommended)

    • Solvate the system with explicit water molecules and appropriate ion concentrations

    • Use specialized force fields optimized for membrane proteins (CHARMM36 or AMBER Lipid17)

  • Simulation Protocols:

    • Equilibration: Gradual release of restraints on protein and lipids (typically 10-50 ns)

    • Production: Long timescale simulations (minimum 500 ns, ideally multiple μs)

    • Enhanced sampling techniques: Accelerated MD or metadynamics to explore conformational space more efficiently

Key Analyses:

  • Conformational Dynamics:

    • Principal Component Analysis (PCA) to identify major motions

    • Root Mean Square Fluctuation (RMSF) analysis to identify flexible regions

    • Transition pathway analysis between different conformational states

  • Substrate Interactions:

    • Potential of Mean Force (PMF) calculations for substrate permeation

    • Identification of substrate binding pockets and key residues

    • Free energy calculations for substrate binding

  • Lipid-Protein Interactions:

    • Analysis of specific lipid binding sites that may regulate function

    • Lipid diffusion around the protein

Integration with Experimental Data:
MD simulations are most powerful when combined with experimental approaches. For y4oQ, researchers have successfully used the combination of EPR spectroscopy and MD to investigate conformational flexibility in ABC transporters, comparing dynamic data with mechanistic predictions from crystal structures . This integrated approach can reveal:

  • Conformational changes during the transport cycle

  • Validation of proposed mechanistic models

  • Effects of mutations on protein dynamics

  • Identification of allosteric communication pathways

By applying these simulation approaches to y4oQ, researchers can generate testable hypotheses about residues critical for function, conformational changes during transport, and the molecular basis of substrate specificity.

What techniques are available for studying the oligomeric state and protein-protein interactions of y4oQ in the ABC transporter complex?

Understanding the oligomeric state and protein-protein interactions of y4oQ is crucial for elucidating its function within the complete ABC transporter complex. Several complementary techniques can be employed to investigate these aspects:

Biochemical and Biophysical Approaches:

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS):

    • Provides accurate molecular weight determination in detergent solutions

    • Can distinguish between monomeric, dimeric, or higher oligomeric states

    • Requires minimal sample modification

  • Analytical Ultracentrifugation (AUC):

    • Sedimentation velocity experiments reveal oligomeric distribution

    • Sedimentation equilibrium provides thermodynamic parameters of association

    • Works well with detergent-solubilized membrane proteins

  • Cross-linking Mass Spectrometry (XL-MS):

    • Identifies interaction interfaces between subunits

    • Various crosslinkers with different spacer lengths can probe different distances

    • MS/MS analysis identifies specific residues involved in interactions

Visualization Techniques:

  • Single-Particle Electron Microscopy:

    • Negative stain EM provides quick assessment of complex formation

    • Cryo-EM can reveal detailed structural information of the assembled complex

    • Particularly valuable for larger ABC transporter assemblies

  • Atomic Force Microscopy (AFM):

    • Can visualize membrane proteins in lipid environments

    • Provides information about topography and organization

Interaction Analysis:

  • Förster Resonance Energy Transfer (FRET):

    • Site-specific labeling with fluorophore pairs

    • Measures distances between 10-100 Å

    • Can be performed in detergent micelles, nanodiscs, or liposomes

  • Bioluminescence Resonance Energy Transfer (BRET):

    • Suitable for in vivo interaction studies

    • Reduced background compared to FRET

  • Native Mass Spectrometry:

    • Emerging technique for intact membrane protein complexes

    • Preserves non-covalent interactions

    • Requires specialized detergent removal approaches

Experimental Planning Table:

TechniqueInformation ObtainedSample RequirementsLimitations
SEC-MALSMolecular weight, oligomeric state50-100 μg purified proteinDetergent contribution must be accounted for
XL-MSInteraction interfaces, proximity mapping10-50 μg purified proteinCrosslinker accessibility dependent
Cryo-EM3D structure of assembled complex100-500 μg highly pure sampleSize limitations for smaller complexes
FRETDynamic interactions, conformational changesSite-specific labelingRequires introduction of fluorophores

For y4oQ specifically, these techniques would help determine how it assembles with other components of the ABC transporter complex, including the nucleotide-binding domains and any accessory proteins. This information is crucial for understanding the complete transport mechanism, as ABC transporters function through coordinated conformational changes between their domains .

How does y4oQ contribute to Rhizobium-legume symbiotic interactions?

The potential role of y4oQ in Rhizobium-legume symbiotic interactions can be inferred from studies of related ABC transporters in Rhizobium species and genomic analyses. While the specific function of y4oQ has not been fully characterized, evidence suggests several possible contributions to symbiosis:

Nutrient Acquisition During Symbiosis:
ABC transporters play critical roles in nutrient acquisition during the symbiotic process. Studies of Rhizobium leguminosarum have demonstrated that certain ABC transporters are involved in glycerol utilization, which affects competition for nodulation . This suggests that y4oQ might be involved in carbon source uptake during symbiotic growth. Within nodules, where metabolism is specialized, such transporters would facilitate the exchange of nutrients between the host plant and bacteria.

Potential Roles in Signaling:
The symbiotic relationship between rhizobia and legumes involves complex molecular signaling. ABC transporters can be involved in:

  • Export of symbiotic signaling molecules

  • Import of plant-derived signals that regulate bacterial gene expression

  • Transport of compounds that modulate plant defense responses

Contribution to Competitive Fitness:
Research has shown that ABC transporters can significantly impact competitive fitness during nodulation. In Rhizobium leguminosarum, the ability to utilize glycerol as a carbon source (mediated by an ABC transporter) affects competition for nodulation . Similar competitive advantages might be conferred by y4oQ, potentially through:

  • More efficient nutrient acquisition from root exudates

  • Utilization of unique carbon sources in the rhizosphere

  • Adaptation to specific microenvironments during infection

Stress Response During Infection:
The infection process exposes rhizobia to various stresses. ABC transporters like y4oQ may contribute to:

  • Detoxification of antimicrobial compounds produced by plants

  • Adaptation to changing osmotic conditions

  • Response to oxidative stress during infection thread development

The genomic analysis of Rhizobium species reveals that these bacteria possess numerous genes encoding diverse metabolic functions, secretion systems for substance transport, and quorum sensing mechanisms, all of which contribute to plant growth stimulation . As part of this complex genetic machinery, y4oQ likely plays a specific role in the transport processes that underpin successful symbiotic interactions.

How can researchers design experiments to elucidate the role of y4oQ in nitrogen fixation?

Designing experiments to elucidate the role of y4oQ in nitrogen fixation requires a multi-faceted approach combining genetic manipulation, biochemical assays, and plant phenotyping:

Genetic Approaches:

  • Gene Disruption and Complementation:

    • Create precise y4oQ deletion mutants using CRISPR-Cas9 or homologous recombination

    • Complement with wild-type gene to confirm phenotype specificity

    • Create point mutations in conserved residues to identify functionally critical amino acids

  • Reporter Gene Fusions:

    • Construct transcriptional and translational fusions with reporters (GFP, LacZ)

    • Monitor expression patterns during different stages of nodule development

    • Identify conditions that regulate y4oQ expression in relation to nitrogenase genes

Biochemical and Molecular Analyses:

  • Metabolite Transport Assays:

    • Measure uptake/export of potential substrates in wild-type vs. mutant bacteria

    • Focus on metabolites relevant to nitrogen fixation (dicarboxylates, amino acids)

    • Use isotope-labeled compounds to track metabolite flux

  • Protein Localization:

    • Use immunogold electron microscopy to localize y4oQ in bacteroids

    • Determine if y4oQ localizes to the peribacteroid membrane or bacteroid inner membrane

    • Track changes in localization during nodule development

Symbiotic Performance Evaluation:

  • Nitrogen Fixation Assays:

    • Acetylene reduction assays to measure nitrogenase activity

    • 15N incorporation studies to quantify nitrogen fixation rates

    • Leghemoglobin content as indicator of nodule functionality

  • Plant Growth Parameters:

    • Compare plant biomass, nitrogen content, and yield between plants inoculated with wild-type vs. y4oQ mutants

    • Conduct time-course experiments to identify when defects manifest

Experimental Design Table for Nitrogen Fixation Studies:

Experimental ApproachMeasurementsControlsExpected Outcomes if y4oQ Affects N2 Fixation
Nitrogenase ActivityAcetylene reduction rateWild-type strain, fixNOQP mutant (negative control)Reduced activity in y4oQ mutant
Plant GrowthShoot dry weight, N contentUninoculated, wild-type inoculatedReduced growth and N content with mutant
Gene ExpressionqRT-PCR of nif genesMultiple housekeeping genesAltered expression pattern in mutant
MetabolomicsCarbon compound profiles in nodulesWild-type nodulesAccumulation/depletion of specific metabolites

Advanced Approaches:

  • Transcriptomics: RNA-seq analysis of both bacterial and plant genes in wild-type vs. y4oQ mutant nodules to identify affected pathways

  • Proteomics: Quantitative proteomics to determine changes in bacteroid protein composition

  • Metabolic Flux Analysis: Use 13C-labeled compounds to track carbon flow through central metabolism in bacteroids

By systematically implementing these approaches, researchers can determine whether y4oQ plays a direct role in nitrogen fixation (e.g., by transporting essential substrates to nitrogenase) or an indirect role (e.g., by affecting bacteroid development or maintenance).

What comparative genomics approaches can reveal the evolutionary significance of y4oQ in different Rhizobium species?

Comparative genomics provides powerful tools to understand the evolutionary significance of y4oQ across different Rhizobium species and its potential role in symbiosis. Here are methodological approaches researchers can employ:

Phylogenetic Analysis:

  • Sequence Acquisition and Alignment:

    • Collect y4oQ homologs from diverse Rhizobium species and related genera

    • Perform multiple sequence alignment using MAFFT or similar tools

    • Identify conserved domains and variable regions

  • Tree Construction:

    • Build phylogenetic trees using maximum likelihood or Bayesian methods

    • Compare y4oQ phylogeny with species phylogeny to detect horizontal gene transfer

    • Identify clades associated with specific host plants or symbiotic capabilities

Synteny and Genomic Context Analysis:

  • Operon Structure Comparison:

    • Analyze gene neighborhood across species to identify conserved operons

    • Determine if y4oQ is consistently associated with specific genes

    • Identify potential regulatory elements conserved across species

  • Plasmid vs. Chromosomal Location:

    • Determine if y4oQ is plasmid-borne (like some symbiotic genes) or chromosomal

    • Assess if location correlates with symbiotic capacity

    • Similar ABC transporters in Rhizobium leguminosarum are plasmid-encoded, suggesting acquisition through horizontal transfer

Selection Pressure Analysis:

  • Positive Selection Detection:

    • Calculate dN/dS ratios to identify signatures of selection

    • Use branch-site models to detect lineage-specific selection

    • Identify specific amino acid sites under selection pressure

  • Correlation with Host Range:

    • Compare y4oQ sequence variation with host plant specificity

    • Identify adaptive mutations associated with different legume hosts

    • Determine if y4oQ diversity contributes to host range determination

Comparative Analysis Table of y4oQ Across Rhizobium Species:

Speciesy4oQ PresentGenomic LocationSelection Pressure (dN/dS)Host PlantsSymbiotic Efficiency
R. leguminosarumYes (homolog)Plasmid[To be determined]Pea, clover[To be determined]
Sinorhizobium frediiYes (y4oQ)[To be determined][To be determined]Soybean[To be determined]
Rhizobium sp. SL42[To be determined][To be determined][To be determined]Amphicarpaea bracteata[To be determined]

Functional Conservation Assessment:

  • Domain Architecture Analysis:

    • Identify conserved functional domains across species

    • Detect lineage-specific domain acquisitions or losses

    • Compare with experimentally characterized ABC transporters

  • Cross-Species Complementation:

    • Test if y4oQ from one species can complement mutations in another

    • Identify species-specific functional constraints

    • Determine the extent of functional conservation

Through these comparative approaches, researchers can determine if y4oQ represents a core component of Rhizobium symbiotic machinery or a specialized adaptation in certain lineages. This evolutionary context is essential for understanding the protein's role in the broader symbiotic process and may reveal how ABC transporters have been specifically adapted for symbiotic functions across different Rhizobium species .

What are the most promising research directions for understanding y4oQ function?

Based on the current state of knowledge, several promising research directions emerge for advancing our understanding of y4oQ function. These approaches combine cutting-edge methodologies with strategic research questions:

  • Structural Biology Integration:
    Combining multiple structural determination methods (X-ray crystallography, Cryo-EM, EPR) with molecular dynamics simulations would provide unprecedented insights into y4oQ's mechanism. Particularly promising is the integration of X-ray radiolytic footprinting with mass spectrometry (XF-MS), which can reveal conformational changes and structural waters critical for function .

  • Systems Biology Approaches:
    Multi-omics integration (transcriptomics, proteomics, metabolomics) applied to both wild-type and y4oQ mutant Rhizobium during symbiosis would reveal the transporter's broader impacts on bacterial physiology and plant interactions. This holistic approach could identify unexpected functional connections beyond direct transport activities.

  • Substrate Identification Using Metabolomics:
    Untargeted metabolomics comparing wild-type and y4oQ mutant bacteria, coupled with direct transport assays, represents the most promising approach to definitively identify transported substrates. Particular focus should be placed on plant-derived compounds present in root exudates and nodules.

  • Synthetic Biology Redesign:
    Engineering y4oQ with altered substrate specificity or improved transport efficiency could both validate our mechanistic understanding and potentially enhance symbiotic nitrogen fixation. This approach could lead to agricultural applications if enhanced transporters improve Rhizobium performance.

  • Host-Range Determinant Investigation:
    The potential role of y4oQ in determining which legume hosts can be effectively nodulated represents an exciting frontier. Systematic testing of y4oQ variants across diverse legume species could reveal if this transporter contributes to host specificity.

These research directions align with broader trends in ABC transporter research and plant-microbe interactions, promising significant advances in our understanding of both basic biological processes and potential agricultural applications.

How might understanding y4oQ function contribute to sustainable agriculture applications?

Understanding the function of y4oQ and similar ABC transporters in Rhizobium could make significant contributions to sustainable agriculture through several pathways:

Enhanced Biological Nitrogen Fixation:
If y4oQ plays a crucial role in nutrient exchange during symbiosis, engineering optimized versions could enhance nitrogen fixation efficiency. This could lead to:

  • Reduced dependency on synthetic nitrogen fertilizers

  • Lower environmental impacts from fertilizer runoff

  • Decreased energy consumption in agriculture (fertilizer production is energy-intensive)

Genomic analysis of Rhizobium strains reveals numerous genes that contribute to plant growth promotion, including transporters that may be involved in symbiotic interactions . Targeted enhancement of key transporters like y4oQ could amplify these beneficial effects.

Improved Rhizobial Inoculants:
Commercial rhizobial inoculants often perform inconsistently in field conditions. Understanding how transporters like y4oQ contribute to:

  • Competitive nodulation ability

  • Stress resilience during soil colonization

  • Efficient carbon utilization in the rhizosphere

could lead to the development of superior inoculant strains. Research on Rhizobium leguminosarum has already demonstrated that ABC transporters involved in glycerol utilization affect competition for nodulation , suggesting that optimizing transporters could create more competitive, field-effective strains.

Extended Host Range Applications:
If y4oQ influences host specificity, engineering variants could potentially:

  • Extend the host range of elite Rhizobium strains

  • Enable effective nodulation of recalcitrant legume crops

  • Improve performance across diverse soil conditions

Bioremediation Applications:
ABC transporters often show substrate promiscuity. Understanding y4oQ function could reveal potential for:

  • Engineering strains for enhanced uptake of soil contaminants

  • Developing rhizoremediation approaches using legume-Rhizobium symbiosis

  • Creating biosensors for environmental monitoring

Potential Application Pathways Table:

Application AreaContribution of y4oQ ResearchTimelineImplementation Challenges
Enhanced InoculantsImproved competitive ability5-8 yearsRegulatory approval, field testing
Breeding ProgramsSelection for compatible plant genotypes8-10 yearsGenetic complexity, field validation
Synthetic BiologyDesigner rhizobia with optimized transporters10-15 yearsRegulatory hurdles, public acceptance
Climate ResilienceStrains adapted to changing conditions5-10 yearsUnpredictable climate variables

By elucidating the fundamental mechanisms of transporters like y4oQ in Rhizobium-legume symbiosis, researchers can develop knowledge-based strategies to enhance sustainable agriculture practices, reducing dependency on chemical inputs while maintaining or improving productivity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.