Recombinant Rhizobium sp. Probable amino-acid ABC transporter permease protein y4tG (NGR_a01520)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your needs during order placement, and we will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Kindly consult your local distributors for precise delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can utilize this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize the development of your specified tag.
Synonyms
NGR_a01520; y4tG; Probable amino-acid ABC transporter permease protein y4tG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a01520
Target Protein Sequence
MLYGFTWDTGNGELAFAISILPMLLMGLITTLQAAFLGFFVACVLGMVFAVLRGMRTRWV AWPAAVLIEFIRDTPLIAQLFFLYYVLPEYGIIFPAFLTGALALGIQYSAYISEVYRGGI QAVDHGQREAAKSLDLPPARTFTHVILPQAIPRVIPALGNYLVSIMKDVPVLSVVTIVEM LNAAKIIGDQTFNYLVPLSMVGGIYLILTIVASALVRIVDVNLPKRGVPLR
Uniprot No.

Target Background

Function
This protein is likely part of the binding-protein-dependent transport system y4tEFGH for an amino acid. It is believed to be responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, HisMQ subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of y4tG in Rhizobium sp. strain NGR234?

The y4tG gene (NGR_a01520) is located on the symbiotic plasmid pNGR234a of Rhizobium sp. strain NGR234. Similar to other symbiotic genes like y4lO, it is likely flanked by insertion sequence elements, suggesting possible transposon-related sequence rearrangements during evolution. The promoter region may contain regulatory elements that respond to plant-derived signals, similar to the tts box found in the promoter region of y4lO that binds the transcriptional activator TtsI. A comprehensive genomic analysis would involve sequencing and annotating the regions upstream and downstream of the y4tG locus to identify potential regulatory elements and associated genes in the ABC transporter operon.

How does the structure of y4tG compare to other ABC transporter permease proteins in rhizobia?

The y4tG protein belongs to the ABC transporter permease family, which typically contains multiple transmembrane domains that form a channel for substrate transport. While specific structural information for y4tG is limited, comparative sequence analysis with characterized ABC transporters in related rhizobial species could reveal conserved domains and motifs. Researchers should perform multiple sequence alignments using tools like MUSCLE or Clustal Omega, followed by phylogenetic analysis to determine evolutionary relationships with other permease proteins. Homology modeling based on crystallized ABC transporters could provide insights into the predicted three-dimensional structure and potential substrate binding sites.

What is the predicted function of y4tG in Rhizobium-legume symbiosis?

As a probable amino acid ABC transporter permease, y4tG likely facilitates the transport of amino acids across the bacterial membrane during symbiotic interactions. By analogy with other symbiotic determinants like Y4lO, y4tG might play a role in nutrient exchange between the rhizobial bacteroids and the host plant cells. The protein could be involved in importing specific amino acids required for bacteroid metabolism or exporting signaling molecules that modulate host responses. Experimental approaches to determine function would include creating deletion mutants (similar to the NGRΩ y4lO strain described for Y4lO) and assessing their symbiotic phenotypes with various legume hosts through nodulation assays and microscopic analysis.

What are the optimal conditions for expressing recombinant y4tG protein?

For recombinant expression of y4tG, researchers should consider the following methodological approach:

  • Construct design: Clone the y4tG gene into an expression vector with an appropriate promoter (e.g., T7) and affinity tag (e.g., His-tag) for purification.

  • Expression system selection: For membrane proteins like y4tG, specialized expression systems such as E. coli C43(DE3) or Lemo21(DE3) strains may be preferable to standard BL21(DE3).

  • Culture conditions: Initial expression trials should test various temperatures (16°C, 25°C, 30°C), IPTG concentrations (0.1-1.0 mM), and induction times (4h to overnight).

  • Membrane extraction: Use detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) for extraction from membranes.

Protein expression can be monitored by SDS-PAGE and Western blotting using antibodies against the affinity tag. Optimization may require a factorial design approach, systematically varying expression parameters to maximize yield of functional protein.

How can researchers effectively generate and characterize y4tG knockout mutants?

To generate y4tG knockout mutants for functional studies, follow this methodological workflow:

  • Construct design: Create a suicide vector containing y4tG flanking regions with an antibiotic resistance cassette inserted between them.

  • Transformation: Introduce the construct into Rhizobium sp. NGR234 via triparental mating or electroporation.

  • Selection: Identify double crossover events through antibiotic resistance screening and PCR verification.

  • Complementation: Create a complementation construct by cloning the wild-type y4tG gene into a broad-host-range plasmid under its native promoter.

For phenotypic characterization, compare the mutant (NGRΩ y4tG) with wild-type NGR234 and complemented strains across multiple parameters:

  • Growth rates in various media

  • Nodulation efficiency on different legume hosts

  • Nitrogen fixation capacity (acetylene reduction assay)

  • Bacteroid differentiation and symbiosome formation (electron microscopy)

  • Transcriptome analysis to identify compensatory responses

This approach mirrors the successful characterization of Y4lO mutants, which revealed critical roles in symbiosome differentiation and nodule senescence.

What methods should be used to analyze the transport activity of y4tG in vitro?

For in vitro transport activity assays of y4tG, researchers should:

  • Membrane vesicle preparation: Isolate right-side-out or inside-out membrane vesicles from cells expressing y4tG.

  • Substrate selection: Test a panel of radiolabeled amino acids as potential substrates.

  • Transport assay setup:

    • Incubate vesicles with potential substrates in the presence or absence of ATP

    • Include appropriate controls (ATP analogs, ionophores, competitive inhibitors)

    • Monitor substrate accumulation over time

  • Data analysis: Calculate initial rates and kinetic parameters (Km, Vmax)

SubstrateTransport Rate (nmol/min/mg protein)
+ATP-ATP+ATP+CCCP+ATP+Vanadate
L-Glutamate24.3±2.13.2±0.45.1±0.76.3±0.8
L-Aspartate18.7±1.92.8±0.34.2±0.55.8±0.6
L-Alanine6.4±0.81.5±0.22.1±0.32.3±0.4
L-Leucine2.1±0.31.3±0.21.4±0.21.5±0.3

This hypothetical data table illustrates how transport activity could be quantified with different substrates and inhibitors, revealing substrate preference and energy dependence.

How does y4tG interact with other components of the symbiotic signaling pathway in Rhizobium sp. NGR234?

Investigating the interactions between y4tG and other symbiotic components requires a multifaceted approach:

  • Co-immunoprecipitation: Using epitope-tagged y4tG to pull down interacting proteins, followed by mass spectrometry identification.

  • Bacterial two-hybrid assays: Testing direct interactions with candidate proteins, including other ABC transporter components (ATPase, substrate-binding proteins) and known symbiotic regulators.

  • Transcriptome analysis: Comparing gene expression profiles of wild-type and y4tG mutants under symbiotic conditions to identify co-regulated genes.

  • Double mutant analysis: Creating and characterizing double mutants of y4tG with other symbiotic genes (e.g., y4tG/y4lO double mutant) to assess genetic interactions.

By analogy with Y4lO, which mitigates the senescence-inducing effects of the T3 effector NopL, y4tG might interact with specific symbiotic pathways to modulate host responses. The synergistic effects observed for Y4lO and NopL in nitrogen-fixing nodules might have parallels in y4tG interactions with other transporters or effectors, potentially revealing novel regulatory networks in the Rhizobium-legume symbiosis.

What role does y4tG play in the differentiation of symbiosomes compared to other symbiotic determinants like Y4lO?

To elucidate the potential role of y4tG in symbiosome differentiation, researchers should conduct comparative ultrastructural analysis similar to that performed for Y4lO:

  • Electron microscopy: Examine nodules induced by wild-type NGR234, y4tG mutants, and complemented strains at different developmental stages.

  • Immunogold labeling: Localize y4tG protein within bacteroids and symbiosomes using specific antibodies.

  • Time-course analysis: Monitor symbiosome development from infection droplet formation to mature nitrogen-fixing symbiosomes.

Y4lO has been shown to be critical for proper symbiosome differentiation, with y4lO mutants exhibiting abnormal enlargement of infection droplets and premature nodule senescence. If y4tG functions in amino acid transport across the symbiosome membrane, its mutation might similarly affect bacteroid metabolism and symbiosome development, potentially resulting in:

  • Altered bacteroid morphology

  • Changes in poly-β-hydroxybutyrate accumulation

  • Defects in symbiosome membrane formation or function

  • Modified patterns of nitrogen fixation and nodule senescence

How does the regulation of y4tG expression differ across various environmental conditions and host legumes?

To investigate the regulation of y4tG expression, researchers should implement:

  • Promoter-reporter fusions: Create transcriptional fusions of the y4tG promoter region with reporter genes (gusA, gfp) and monitor activity under different conditions.

  • qRT-PCR analysis: Quantify y4tG transcript levels in response to:

    • Plant flavonoids and other symbiotic signals

    • Different carbon and nitrogen sources

    • Oxygen concentrations

    • pH and osmotic stress

  • Chromatin immunoprecipitation (ChIP): Identify transcription factors binding to the y4tG promoter region.

  • Host-specific expression: Compare y4tG expression during symbiosis with different legume hosts.

ConditionRelative y4tG Expression
Minimal medium1.0 (baseline)
+ Daidzein (1 μM)3.2±0.4
+ Genistein (1 μM)4.8±0.5
+ Apigenin (1 μM)5.6±0.6
Microaerobic (2% O₂)7.3±0.8
Nodule extracts - P. vulgaris8.9±1.1
Nodule extracts - T. vogelii6.7±0.9

This hypothetical data table illustrates how y4tG expression might respond to various symbiotic signals and host environments, potentially revealing host-specific regulation patterns similar to those observed with other symbiotic genes.

How can researchers address solubility issues when purifying recombinant y4tG protein?

Membrane proteins like y4tG present significant purification challenges. Researchers encountering solubility issues should implement the following strategies:

  • Detergent screening: Systematically test 8-12 different detergents including:

    • Mild detergents (DDM, LMNG)

    • Zwitterionic detergents (CHAPSO, Fos-choline)

    • Non-ionic detergents (Triton X-100, digitonin)

    • Novel amphipols or nanodiscs for stability

  • Fusion partners: Incorporate solubility-enhancing tags like MBP (maltose-binding protein) or SUMO at the N-terminus.

  • Buffer optimization:

    • Test pH range (6.0-8.5)

    • Vary salt concentration (100-500 mM NaCl)

    • Add stabilizing agents (glycerol 5-20%, specific lipids)

  • Expression modifications:

    • Reduce expression temperature to 16°C

    • Use auto-induction media

    • Consider cell-free expression systems

Document purification outcomes using SEC-MALS (size exclusion chromatography with multi-angle light scattering) to assess homogeneity and oligomeric state of the purified protein.

What approaches can resolve inconsistent phenotypes observed in y4tG mutant studies across different host plants?

When facing variable or inconsistent phenotypes in host-dependent studies of y4tG mutants, apply these methodological approaches:

  • Standardize experimental conditions:

    • Use consistent growth media and plant cultivation systems

    • Control environmental parameters (light, temperature, humidity)

    • Standardize inoculum preparation and application

  • Increase biological replication:

    • Use multiple plant varieties/accessions within each species

    • Increase sample sizes to account for plant-to-plant variation

    • Perform independent experiments across different seasons

  • Implement mixed-model statistical analysis:

    • Account for random effects (experimental batches, plant variability)

    • Use appropriate transformations for non-normal data

    • Apply false discovery rate corrections for multiple comparisons

  • Investigate host-specific genetic factors:

    • Perform transcriptome analysis of different host plants during infection

    • Screen plant genotypes for differential responses

    • Consider plant hormone levels and immune responses

How should conflicting transport substrate specificity data for y4tG be interpreted?

When confronted with conflicting substrate specificity data for y4tG, implement this analytical framework:

  • Methodological comparison:

    • Catalog differences in experimental approaches (in vivo vs. in vitro)

    • Evaluate protein preparation methods (detergent types, purification conditions)

    • Assess assay conditions (pH, temperature, buffer composition)

  • Data normalization and reanalysis:

    • Standardize data presentation across studies

    • Reanalyze raw data using consistent statistical methods

    • Generate Eadie-Hofstee or Lineweaver-Burk plots for kinetic comparisons

  • Biological context consideration:

    • Evaluate co-expression of accessory proteins across studies

    • Consider post-translational modifications

    • Assess lipid environment effects on transporter function

  • Validation experiments:

    • Design definitive experiments combining multiple approaches

    • Use isothermal titration calorimetry (ITC) to measure direct binding affinities

    • Implement in vivo transport assays with radioactive substrates

StudySystemPrimary SubstrateKm (μM)Secondary SubstratesInhibitors
Zhang et al.Membrane vesiclesL-Glutamate45±7L-Aspartate, L-GlutamineCCCP, Vanadate
Li et al.ProteoliposomesL-Aspartate62±9L-Glutamate, L-AsparagineN-ethylmaleimide
Wang et al.Whole cellsL-Glutamine118±15L-Glutamate, γ-AminobutyrateAzaserine
Park et al.NanodiscsL-Glutamate38±6L-Aspartate, L-MethionineAMP-PNP

This hypothetical data table illustrates how seemingly conflicting substrate specificity data might be systematically compared across different experimental systems, highlighting methodological differences that could explain discrepancies.

What approaches could reveal the role of y4tG in Rhizobium adaptation to diverse legume hosts?

To investigate the role of y4tG in host adaptation, researchers should consider these forward-looking approaches:

  • Comparative genomics:

    • Sequence y4tG homologs across diverse Rhizobium strains with different host ranges

    • Identify correlations between y4tG sequence variants and host specificity

    • Apply evolutionary analysis to detect selection signatures

  • Host transfer experiments:

    • Introduce y4tG variants from different rhizobial strains into NGR234

    • Test chimeric proteins with domains swapped between y4tG homologs

    • Evaluate nodulation and nitrogen fixation efficiency across diverse hosts

  • Metabolomic profiling:

    • Compare amino acid profiles in nodules formed by wild-type and y4tG mutants

    • Track isotope-labeled amino acid flux between plant and bacteroid

    • Identify host-specific metabolite signatures

  • Systems biology integration:

    • Create network models incorporating y4tG with other symbiotic components

    • Simulate metabolic interactions between plant and bacteroid

    • Predict host-specific adaptation mechanisms

This multifaceted approach could reveal whether y4tG, like Y4lO, contributes to host-specific symbiotic outcomes and whether different variants of the transporter have evolved to accommodate the metabolic requirements of diverse legume partners.

How might CRISPR-Cas9 genome editing be applied to study the function of y4tG in Rhizobium sp. NGR234?

CRISPR-Cas9 technology offers powerful new approaches for studying y4tG function:

  • Precise gene editing:

    • Create clean deletions without antibiotic resistance markers

    • Introduce point mutations to study specific protein domains

    • Generate fluorescent protein fusions at the native locus

  • CRISPRi for conditional knockdowns:

    • Develop dCas9-based repression systems for rhizobia

    • Create inducible knockdowns to study y4tG at specific symbiotic stages

    • Target multiple ABC transporters simultaneously to address redundancy

  • CRISPRa for overexpression studies:

    • Use dCas9-activator fusions to enhance y4tG expression

    • Test effects of increased transporter levels on symbiotic efficiency

    • Evaluate potential biotechnological applications

  • Base editing applications:

    • Introduce specific amino acid changes without double-strand breaks

    • Create libraries of y4tG variants with altered substrate specificity

    • Engineer optimized transporters for enhanced symbiotic performance

Implementation would require adaptation of CRISPR tools for rhizobial systems, potentially using broad-host-range vectors and codon-optimized Cas9 variants, followed by comprehensive phenotypic analysis similar to that performed for Y4lO mutants.

What potential biotechnological applications could emerge from understanding y4tG function in Rhizobium-legume symbiosis?

Understanding y4tG function could lead to several biotechnological applications:

  • Enhanced biofertilizers:

    • Engineer rhizobia with optimized y4tG variants for improved nutrient exchange

    • Develop strains with broader host ranges through modified transporters

    • Create rhizobial consortia with complementary transport capabilities

  • Biosensors development:

    • Utilize y4tG substrate specificity to create amino acid biosensors

    • Develop whole-cell biosensors for soil nutrient monitoring

    • Create diagnostic tools for assessing symbiotic efficiency

  • Synthetic biology applications:

    • Incorporate y4tG into designer microbes for specialized amino acid transport

    • Develop synthetic symbioses with non-legume crops

    • Engineer metabolic pathways that interface with y4tG transport

  • Structural biology insights:

    • Use y4tG structure determination to inform broader ABC transporter research

    • Develop novel inhibitors of related transporters in pathogenic bacteria

    • Enhance protein engineering approaches for membrane proteins

These applications represent the translational potential of fundamental research on rhizobial ABC transporters, extending beyond agricultural applications to broader biotechnology fields while maintaining focus on the academic research context rather than commercial applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.