Recombinant Rhizobium sp. Probable chemoreceptor y4sI (NGR_a01640)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare accordingly.
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please consult your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a01640; y4sI; Probable chemoreceptor y4sI; Methyl-accepting chemotaxis protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-756
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a01640
Target Protein Sequence
MGGRMPLLNVSPLKWPISLKIPAMTVCVAVLSCTTVATFAGITSVATTRSLIEKHLNYVA
ISMRDALLTKLQATKFEVEGLSANPGLLQLFNNTSVGFAAVSPTDLTAASVDKVESGKFS
LAATPTTKFYVDNYQKLDAWLKPLAAKQSYSGILLANAEGAIIYSTGTNPVGPVDANGSI
NLAIASSANSQEAVMTDFTPPTLSAPGQALYAVAIVHPFIPDKRNGTLLISMSTEMLNAV
MGQAKGFGPHSEALIAGSDGKPRSLSSISRDEDAEAVVNSDLLSQGIKTSNFGAQEVLSA
SQQLKWQDHQWSIIALEPEADVVSASTAMLIKIIGITAATAILALAMAILASRSISGPLA
GLVSIMKRLANGDINVRVAGVDRRDEMGEMSRAVLVFRDNAIARVAAEDDARSAEEAMEH
DRRMMEMERSERLDEQARVMAQIGGGLAALSDGVFSRPITVDFPEEYRPLKSDFNRALGQ
LRETIRTVAAQAASMSSIVSEISCATDVLAKRTEHQAIVLDGAVNTMDAISNDVSVTANA
ANNADALVRDAHSAAAASDEIVSSAIAGMLEIEESSAKIATIVSVIEEIAHQTNLLALNA
GVEASRAGEAGKGFAVVASEVRALAQRSSDAAKEIKDLINVSTQRVERGKELVDSASELL
KHIAARVDLIRTTVSNIAATATSQAKHLSEFQTTIAEIDQSTQQTAAMAEESDAACRSLN
AEAQHLLELIQQFELGGGSSTRQPQSPPTQRYFMSR
Uniprot No.
Target Background
Function
Chemotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment. They transduce a signal from the external environment to the cell's interior, facilitating sensory adaptation through variations in methylation levels. Attractants increase methylation levels, while repellents decrease them.
Database Links
KEGG: rhi:NGR_a01640
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
