Recombinant Rhizobium sp. Probable conjugal transfer protein trbC (trbC)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhizobium sp. Probable Conjugal Transfer Protein TrbC (TrbC)

Rhizobium sp. probable conjugal transfer protein TrbC (TrbC) is a protein that is likely involved in the transfer of genetic material between bacterial cells, a process known as conjugation . This protein is found in Rhizobium species, which are bacteria known for their symbiotic relationship with plants, particularly legumes, where they fix nitrogen . The trbC gene, which encodes the TrbC protein, is often located on plasmids, circular DNA molecules that can be transferred between bacteria .

Protein Information

FeatureDescription
Official Full NameRecombinant Rhizobium sp. Probable Conjugal Transfer Protein TrbC (TrbC)
Source (Host)E. coli
SpeciesSinorhizobium fredii , Rhizobium radiobacter
TagHis-Tagged
Protein LengthFull Length (1-127)
Gene NametrbC
Ordered Locus NamesNGR_a04200
ORF Namesy4cN
Expression Region1-127
AA SequenceMSRKNEFISIALLASPLILASVAPALASSGGSLPWEGPLEQIQESITGPVAGYIALAAVA IAGGMLIFGGELNDFARRLMYVVLVAGILLGATTIVGLFGATGASIGLTNDRATSTRPSAEGEGAHG

Function

The TrbC protein likely plays a role in bacterial conjugation, specifically in the mating pair formation (Mpf) system . The Mpf system is essential for the establishment of physical contact between bacterial cells, which is necessary for the transfer of DNA .

Functions:

  • Conjugal transfer of genetic material

  • Mating pair formation

  • Establishment of physical contact between bacterial cells

Conjugal Transfer

Conjugal transfer is a crucial mechanism for the spread of genetic information in bacteria, including antibiotic resistance genes and genes involved in symbiosis . The trbC gene is often found within clusters of genes responsible for replication and conjugal transfer .

Role in Rhizobium - Legume Symbiosis

Rhizobium bacteria establish a symbiotic relationship with legumes, forming nodules on the plant roots where they fix atmospheric nitrogen into ammonia, which the plant can use for growth . The ability to transfer genetic material via conjugation can contribute to the adaptation and evolution of Rhizobium populations, potentially enhancing their symbiotic efficiency or allowing them to colonize new host plants .

Pathways Involved

The TrbC protein participates in various pathways that are essential for bacterial survival and interaction with the environment . These pathways may include:

  • Conjugation pathway

  • Quorum sensing-dependent regulation

Interactions

TrbC interacts with other proteins and molecules to perform its functions . These interactions are essential for the formation of the transfer apparatus and the regulation of the conjugation process .

Research Findings

  • Identification of Novel Rhizobium Species: Studies have identified and characterized novel Rhizobium species based on phylogenetic and phenotypic data, indicating the diversity and evolutionary potential of this genus .

  • Rhizobium Mutant Analysis: Research on Rhizobium mutants has revealed the importance of specific genes and proteins in the symbiotic interaction with host plants .

  • Genomic Analysis: Genomic sequencing of Rhizobium plasmids has provided insights into the organization and function of genes involved in replication, conjugation, and symbiosis .

  • Conjugation Studies: Investigations into the conjugative transfer of plasmids in Rhizobium have shed light on the mechanisms and regulation of this process, highlighting its role in bacterial adaptation and evolution .

  • Mating Pair Formation: Components of the RP4 conjugative transfer apparatus form an envelope-spanning structure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
trbC; NGR_a04200; y4cN; Probable conjugal transfer protein TrbC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
trbC
Target Protein Sequence
MSRKNEFISIALLASPLILASVAPALASSGGSLPWEGPLEQIQESITGPVAGYIALAAVA IAGGMLIFGGELNDFARRLMYVVLVAGILLGATTIVGLFGATGASIGLTNDRATSTRPSA EGEGAHG
Uniprot No.

Target Background

Database Links
Protein Families
TrbC family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of TrbC protein in Rhizobium species?

TrbC protein functions as a critical component of the type IV secretion system (T4SS) in Rhizobium species. Based on studies of related conjugal transfer proteins, TrbC is involved in the assembly of the mating pair formation (Mpf) complex, which forms a channel for DNA transfer during bacterial conjugation. This channel is essential for the horizontal transfer of plasmids carrying symbiosis genes that enable rhizobia to establish nitrogen-fixing relationships with legume hosts .

The functional significance of TrbC can be understood in the context of the broader trb gene cluster that encodes components of the conjugation machinery. Similar to other Trb proteins like TrbE and TrbI, TrbC likely contributes to the structural integrity and functionality of the conjugation apparatus that facilitates the transfer of genetic material between bacterial cells .

How is the trbC gene organized within the Rhizobium genome?

The trbC gene is typically located within a cluster of transfer (tra/trb) genes on self-transmissible plasmids in Rhizobium species. In R. leguminosarum, these genes are organized in an operon structure near the origin of transfer (oriT) . The genomic context of trbC includes:

  • Proximity to other conjugation genes including trbE, trbI, traG, and traA

  • Regulatory elements such as the trbR repressor gene, which controls expression of the trb operon

  • Possible association with symbiotic regions of the genome, as conjugation systems are often involved in transferring symbiotic islands

This organization reflects the functional integration of TrbC within the conjugation machinery and its co-regulation with other components of the system .

What is the relationship between TrbC and other conjugal transfer proteins?

TrbC functions within a complex network of conjugal transfer proteins that collectively enable plasmid transfer. Key relationships include:

  • Structural relationships: TrbC works in concert with other Trb proteins (TrbE, TrbI) to form the structural components of the conjugation channel

  • Functional dependencies: Experimental evidence from R. leguminosarum indicates that disruption of genes like trbE, trbI, traG, or traA completely abolishes plasmid transfer, suggesting TrbC operates within this interdependent system

  • Regulatory interactions: Expression of trbC is controlled by the TrbR repressor, which regulates the entire trb operon

The interdependence of these proteins is demonstrated by mutation studies showing that defects in any single component can disrupt the entire conjugation process, highlighting the integrated nature of this molecular machinery .

What are the most effective methods for expressing and purifying recombinant TrbC protein?

Successful expression and purification of recombinant TrbC requires optimization at multiple steps:

StageMethodologyTechnical Considerations
CloningPCR amplification of trbC gene with appropriate restriction sitesCodon optimization may improve expression
Expression vectorpET or pGEX systems with inducible promotersN-terminal or C-terminal tags based on protein topology
Expression hostE. coli BL21(DE3) or Rosetta for rare codonsConsider membrane protein expression strains
Induction conditionsIPTG 0.1-0.5 mM, 16-25°C for 4-16 hoursLower temperatures improve solubility
Cell lysisSonication or French press in buffer with protease inhibitorsGentle detergents may be needed (DDM, CHAPS)
PurificationNi-NTA or glutathione affinity chromatographyOptimize detergent concentration for membrane proteins
Secondary purificationSize exclusion chromatographyAssess oligomeric state
Quality controlSDS-PAGE, Western blot, mass spectrometryVerify intact protein and correct modifications

As TrbC likely contains transmembrane domains, specialized approaches for membrane protein purification may be necessary, including screening different detergents and incorporating stabilizing agents in the purification buffers .

How can researchers effectively create and validate trbC mutants in Rhizobium species?

Creating and validating trbC mutants requires a systematic approach:

  • Mutant construction strategies:

    • Insertional mutagenesis using a suicide vector (e.g., pJQ200SK) carrying an internal fragment of trbC disrupted with an antibiotic resistance cassette

    • Transposon mutagenesis using EZ-Tn5 system, similar to the approach used for other trb genes in R. leguminosarum

    • Precise deletion using homologous recombination with selection/counter-selection systems

  • Validation methods:

    • Molecular verification: PCR, Southern blotting, and sequencing to confirm correct insertion/deletion

    • Transcriptional analysis: RT-PCR or RNA-Seq to verify absence of trbC transcript

    • Protein analysis: Western blotting with anti-TrbC antibodies

  • Functional validation:

    • Conjugation frequency assays comparing wild-type and mutant strains

    • Complementation with wild-type trbC to restore phenotype

    • Microscopy to visualize effects on conjugation apparatus formation

When analyzing conjugation phenotypes, it's essential to use appropriate controls and statistical methods to account for the natural variability in conjugation frequencies .

What techniques are recommended for studying TrbC protein interactions with other components of the conjugation machinery?

Multiple complementary approaches should be employed to characterize TrbC interactions:

TechniqueApplicationAdvantagesLimitations
Bacterial two-hybridIn vivo protein-protein interactionsWorks in bacterial contextMay miss membrane protein interactions
Co-immunoprecipitationPhysical interactions in cell lysatesCaptures native complexesRequires specific antibodies
Pull-down assaysDirect binding partnersIdentifies primary interactionsMay miss transient interactions
Crosslinking + MSSpatial relationships in complexesCaptures transient interactionsComplex data interpretation
FRET/BRETIn vivo interactions and dynamicsReal-time monitoringRequires fluorescent protein fusions
Surface plasmon resonanceBinding kinetics and affinityQuantitative measurementsRequires purified proteins
Cryo-EMStructural organization of complexesVisualizes entire machineryTechnical challenges with membrane complexes

A multimodal approach is particularly important for TrbC, as it functions within a complex multiprotein assembly spanning bacterial membranes. Studies in R. leguminosarum have demonstrated the interdependence of proteins like TrbE, TrbI, TraG, and TraA, suggesting they form a functional complex in which TrbC likely participates .

How does the regulatory network control trbC expression under different environmental conditions?

The expression of trbC is governed by a sophisticated regulatory network:

  • Direct regulation:

    • TrbR functions as a repressor of the trb operon, including trbC, as demonstrated in R. leguminosarum

    • Mutation of trbR leads to increased expression of trb genes and elevated conjugation frequencies

  • Environmental influences:

    • Plant root exudates may modulate expression of conjugation genes, as observed with traG in Mesorhizobium

    • Nutrient availability, particularly nitrogen status, affects expression through global regulators like NtrC

    • Oxygen levels in the rhizosphere may influence conjugation gene expression

  • Experimental approaches for studying regulation:

    • Promoter-reporter fusions to monitor trbC expression under varying conditions

    • ChIP-seq to identify transcription factor binding sites

    • RNA-seq to analyze transcriptome changes in response to environmental signals

    • DNA footprinting to map regulatory protein binding sites

The complex regulatory architecture suggests that trbC expression is precisely controlled to ensure conjugation occurs under appropriate conditions, such as in the plant rhizosphere where horizontal gene transfer may provide adaptive advantages .

How does the evolution of trbC correlate with horizontal gene transfer of symbiotic islands in Rhizobium species?

The evolution of trbC is intricately linked to horizontal gene transfer (HGT) of symbiotic traits:

  • Genomic evidence:

    • The location of T4SS genes (including trb genes) in the symbiotic region of rhizobial genomes suggests co-transfer with symbiosis genes

    • Phylogenetic analyses often show incongruence between conjugation genes and core genome phylogeny, indicating HGT events

  • Functional implications:

    • TrbC-containing conjugation systems facilitate the transfer of plasmids carrying nod, nif, and fix genes essential for symbiosis

    • This mechanism allows conversion of non-symbiotic rhizobia into symbiotic strains through a single HGT event

  • Host specificity correlation:

    • Evidence from Mesorhizobium suggests that transfer genes like traG are conserved across strains able to nodulate the same host plant

    • This pattern indicates potential co-evolution of conjugation machinery with host-specific symbiotic traits

This relationship highlights the evolutionary significance of TrbC in facilitating the spread of symbiotic capabilities across rhizobial populations, contributing to their adaptation to different legume hosts .

What structural features of TrbC are critical for its function in the type IV secretion system?

The structural determinants of TrbC function include:

  • Predicted domain architecture:

    • Transmembrane domains that anchor TrbC in the bacterial membrane

    • Periplasmic domains that interact with other components of the T4SS

    • Conserved motifs involved in protein-protein interactions or channel formation

  • Structure-function analysis approaches:

    • Site-directed mutagenesis of conserved residues to identify functional domains

    • Domain swapping experiments with homologs from other systems

    • Structural prediction using homology modeling based on related T4SS components

  • Assembly dynamics:

    • TrbC likely participates in a stepwise assembly process of the T4SS

    • Interactions with proteins like TrbE and TrbI create a functional transfer channel

    • Spatial organization within the membrane is critical for function

Understanding these structural features requires integration of computational predictions with experimental validation through approaches like mutagenesis and interaction studies. The functional dependence on other T4SS components, as demonstrated in R. leguminosarum, suggests that TrbC occupies a specific position within the three-dimensional architecture of the conjugation machinery .

What are the main technical challenges in studying TrbC function and how can they be overcome?

Researchers face several significant challenges when investigating TrbC:

  • Membrane protein experimental difficulties:

    • Challenge: Poor solubility and stability during expression and purification

    • Solution: Use specialized detergents, fusion partners designed for membrane proteins, and expression systems optimized for membrane proteins

  • Genetic manipulation complexities:

    • Challenge: Lower transformation efficiency in Rhizobium compared to model organisms

    • Solution: Optimize electroporation protocols, use broad-host-range vectors, and develop Rhizobium-specific genetic tools

  • Complex multiprotein interactions:

    • Challenge: Difficulty isolating and studying individual components of the T4SS

    • Solution: Use in situ approaches like protein crosslinking, proximity labeling, and super-resolution microscopy

  • Variable conjugation frequencies:

    • Challenge: High variability in conjugation assays complicates phenotypic analysis

    • Solution: Increase biological replicates, standardize growth conditions, and use statistical methods appropriate for highly variable data

Overcoming these challenges often requires adapting techniques from fields like membrane protein biochemistry and developing Rhizobium-specific protocols rather than relying on approaches optimized for model organisms.

How can researchers distinguish between the roles of TrbC and functionally related proteins in conjugation studies?

Differentiating the specific contributions of TrbC from other conjugation proteins requires:

  • Genetic dissection strategies:

    • Construction of precise deletion mutants rather than insertion mutants that might have polar effects

    • Creation of double and triple mutants to reveal functional redundancy or interdependence

    • Complementation with chimeric proteins to map functional domains

  • Protein localization and dynamics:

    • Fluorescent protein fusions to track localization during conjugation

    • Time-lapse microscopy to determine the order of protein recruitment

    • Subcellular fractionation to determine membrane association patterns

  • Biochemical approaches:

    • In vitro reconstitution of subcomplexes with defined components

    • Activity assays for specific functions (e.g., ATPase activity, pilus formation)

    • Structural studies of subcomplexes versus complete assemblies

Studies in R. leguminosarum have demonstrated that mutations in genes like trbE, trbI, traG, and traA all abolish plasmid transfer, suggesting they form an interdependent functional unit . Teasing apart their individual contributions requires combining these approaches with careful experimental design and controls.

What statistical methods are most appropriate for analyzing conjugation frequency data in trbC mutant studies?

Conjugation frequency data present unique statistical challenges:

Statistical ApproachApplicationImplementation
Log transformationNormalize distribution of conjugation frequenciesApply log10 transformation before statistical testing
ANOVA with post-hoc testsCompare multiple strains/conditionsUse Tukey's HSD for pairwise comparisons after significant ANOVA
Non-parametric testsWhen data violate normality assumptionsKruskal-Wallis followed by Dunn's test for multiple comparisons
Mixed-effects modelsAccount for batch-to-batch variationInclude experimental batch as random effect
Power analysisDetermine required sample sizeBased on preliminary data variability
BootstrappingGenerate confidence intervalsUseful for highly variable data with small sample sizes

When reporting conjugation frequencies, it's important to:

  • Present both raw and transformed data

  • Include appropriate measures of variability (standard deviation or standard error)

  • Report exact p-values and effect sizes

  • Normalize to appropriate controls within each experiment

How does TrbC-mediated conjugation influence the evolution and spread of symbiotic genes in rhizobial populations?

TrbC-mediated conjugation has profound evolutionary implications:

  • Horizontal gene transfer dynamics:

    • Facilitates the transfer of complete symbiotic islands or plasmids between compatible strains

    • Enables rapid acquisition of symbiotic capabilities by previously non-symbiotic bacteria

    • Creates mosaic genome structures through recombination of transferred DNA segments

  • Population-level consequences:

    • Increases genetic diversity within rhizobial populations

    • Accelerates adaptation to new host plants or environmental conditions

    • Shapes the biogeography of symbiotic capabilities across soil ecosystems

  • Evolutionary significance:

    • The co-location of conjugation genes with symbiotic genes on mobile elements suggests co-evolution of these systems

    • Conservation of transfer genes like traG across strains nodulating the same host plant indicates selective pressure to maintain conjugation capabilities within specific symbiotic groups

This process represents a major mechanism driving rhizobial evolution, allowing rapid adaptation to new niches and contributing to the diversity of rhizobium-legume symbioses observed in nature .

How do environmental factors affect TrbC-dependent conjugation in soil and rhizosphere environments?

Environmental factors significantly impact conjugation efficiency:

Environmental FactorEffect on ConjugationExperimental Evidence
Soil moistureHigher moisture increases cell contact and conjugationConjugation rates correlate with soil water content
TemperatureOptimal range for protein function and bacterial metabolismTemperature-dependent conjugation frequencies
pHAffects protein stability and cell surface propertiesConjugation efficiency varies with soil pH
Plant root exudatesMay induce expression of conjugation genestraG expression responds to plant exudates in Mesorhizobium
Nitrogen availabilityInfluences expression through regulatory networksNtrC regulates gene expression in response to nitrogen status
Microbial communityCompetition or synergism with other microorganismsTransfer rates differ in sterile vs. non-sterile soil

The complex interplay of these factors creates microenvironmental niches where conjugation may be favored or suppressed. For example, plant root exudates may stimulate expression of conjugation genes in the rhizosphere, as observed with traG in Mesorhizobium, potentially promoting horizontal gene transfer in this environment .

What is the relationship between TrbC function and the efficiency of nitrogen fixation in Rhizobium-legume symbiosis?

The connection between TrbC and symbiotic efficiency operates at multiple levels:

  • Indirect effects via horizontal gene transfer:

    • TrbC-containing conjugation systems enable transfer of symbiotic plasmids or islands

    • This promotes the spread of beneficial symbiotic genes through rhizobial populations

    • Allows adaptation to new host plants through acquisition of appropriate nodulation genes

  • Regulatory interconnections:

    • Nitrogen status signaling through the NtrBC system may influence expression of conjugation genes

    • Environmental cues that trigger symbiosis may also affect conjugation efficiency

    • TrbR-mediated regulation responds to environmental signals that may correlate with symbiotic conditions

  • Evolutionary implications:

    • Conservation of transfer genes like traG across strains nodulating the same host plant suggests linkage between conjugation and host specificity

    • Co-transfer of conjugation genes with symbiosis genes maintains this functional linkage across evolutionary time

While TrbC primarily functions in conjugation rather than directly in symbiosis, its role in facilitating horizontal gene transfer has profound implications for the evolution and diversification of rhizobium-legume symbioses .

What emerging technologies could advance our understanding of TrbC structure and function?

Several cutting-edge approaches hold promise for TrbC research:

  • Advanced structural biology techniques:

    • Cryo-electron tomography to visualize intact conjugation machinery in situ

    • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

    • Single-particle cryo-EM to determine high-resolution structures of TrbC-containing complexes

  • Novel genetic tools:

    • CRISPR-Cas9 genome editing optimized for Rhizobium species

    • Multiplexed genome engineering to create combinatorial mutations

    • CRISPRi for tunable gene repression without permanent modification

  • Systems biology approaches:

    • Multi-omics integration combining transcriptomics, proteomics, and metabolomics

    • Network analysis to place TrbC in the broader context of cellular processes

    • Machine learning to predict protein-protein interactions and functional relationships

These technologies could overcome current limitations in studying membrane-associated conjugation systems and provide unprecedented insights into how TrbC contributes to the assembly and function of the T4SS machinery .

How might understanding TrbC function contribute to applications in agricultural biotechnology?

Knowledge of TrbC and conjugation systems has several potential applications:

  • Engineered rhizobial inoculants:

    • Creation of designer rhizobia with optimized conjugation systems for enhanced symbiotic gene transfer

    • Development of strains with controlled conjugation to prevent unwanted gene spread

    • Engineering broader host range capabilities through manipulation of conjugation and symbiosis genes

  • Improved nitrogen fixation:

    • Transfer of enhanced nitrogen fixation capabilities to diverse rhizobial strains

    • Creation of rhizobial communities with complementary symbiotic traits

    • Development of rhizobia adapted to specific agricultural environments

  • Monitoring tools:

    • Biosensors to track horizontal gene transfer in agricultural soils

    • Diagnostic tools to assess rhizobial population dynamics

    • Predictive models for symbiotic performance based on conjugation efficiency

Understanding the molecular mechanisms of conjugation, including TrbC function, provides a foundation for these applications by revealing how symbiotic capabilities spread through rhizobial populations in agricultural systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.