Recombinant Rhizobium sp. Probable conjugal transfer protein trbD (trbD)

Shipped with Ice Packs
In Stock

Description

Functional Role in Bacterial Conjugation

TrbD is a hydrophobic membrane protein encoded within the trb operon of conjugative plasmids. It is essential for assembling the mating pair formation (Mpf) complex, which facilitates DNA transfer between bacteria. Key findings include:

  • Operon Context: In Rhizobium and Agrobacterium, trbD resides in the tra/trb operon, homologous to the Ti plasmid conjugation system .

  • Mechanistic Role: TrbD contributes to the structural integrity of the conjugative pilus and membrane pore formation. Mutational studies in E. coli confirm that trbD is indispensable for plasmid transfer .

  • Regulatory Interactions: TrbD activity is modulated by TraR, a quorum-sensing regulator that activates trb operons in response to N-acyl-homoserine lactone signals .

Applications in Research

  • Conjugation Studies: Used to dissect the molecular machinery of plasmid transfer in nitrogen-fixing rhizobia and pathogenic bacteria .

  • Protein-Protein Interactions: Employed in yeast two-hybrid assays to map interactions with other Trb proteins (e.g., TrbB, TrbC) .

  • Biotechnological Engineering: Serves as a template for modifying conjugation efficiency in synthetic biology applications .

Key Research Findings

Recent studies highlight TrbD’s multifaceted roles:

  • Essentiality: Knockout mutants of trbD in Rhizobium leguminosarum VF39SM abolished plasmid transfer, confirming its necessity .

  • Symbiosis Link: In Bradyrhizobium, TrbD-associated tra/trb operons are chromosomally encoded and critical for host-legume interactions .

  • Regulatory Complexity: TrbD expression is suppressed by CopG1 under non-symbiotic conditions, linking conjugation to environmental sensing .

Challenges and Future Directions

  • Structural Resolution: The absence of a crystallized TrbD structure limits mechanistic insights.

  • Ecological Impact: Further studies are needed to assess TrbD’s role in horizontal gene transfer within soil microbiomes.

  • Engineering Potential: Optimizing TrbD expression could enhance plasmid delivery systems for agricultural or therapeutic applications .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that you may have specific requirements. Please indicate any desired format preferences in your order notes, and we will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for accurate delivery estimates.
Note: Our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing should be avoided. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard protocol includes 50% glycerol; however, customers can adjust this based on their needs.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, and aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we are open to your preferences. If you have a specific tag type in mind, please inform us, and we will prioritize fulfilling your request.
Synonyms
trbD; NGR_a04190; y4cO; Probable conjugal transfer protein TrbD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-99
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
trbD
Target Protein Sequence
MAEALSERYRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVVVWIV IVGLLRMMAKSDPLMRQVYVRHISYKPYYKATTSPWRRY
Uniprot No.

Target Background

Database Links
Protein Families
TrbD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of TrbD in Rhizobium species?

TrbD functions as an essential component of the conjugative machinery in Rhizobium species, specifically involved in pilus formation, assembly, and stability. As part of the type IV secretion system (T4SS), TrbD plays a crucial role in horizontal gene transfer mechanisms, which facilitate the exchange of genetic material between bacterial cells. The protein contributes to the structural integrity of the conjugation apparatus that forms a channel between donor and recipient cells, enabling DNA transfer across cellular boundaries .

To study TrbD function experimentally, researchers typically employ deletion mutants followed by complementation assays. These approaches involve removing the trbD gene from a conjugative plasmid and observing the resulting phenotype, particularly the loss of conjugation efficiency. Subsequent reintroduction of the gene either in cis (on the same plasmid) or in trans (on a separate plasmid) can restore conjugation functionality, confirming TrbD's essential role in this process .

How does TrbD contribute to horizontal gene transfer in Rhizobium?

TrbD is an integral component of the conjugation machinery that mediates horizontal gene transfer (HGT) in Rhizobium species. This protein, along with other Trb proteins, forms part of the type IV secretion system responsible for establishing a physical connection between bacterial cells. Specifically, TrbD participates in the formation and assembly of the conjugative pilus, a filamentous surface appendage that initiates contact with recipient cells .

Methodologically, researchers can quantify TrbD's contribution to horizontal gene transfer by measuring conjugation efficiency. This involves counting transconjugant colonies (recipient cells that have received the conjugative plasmid) and calculating the ratio of transconjugants to donors or recipients. In experimental systems using inducible promoters, deletion of trbD can reduce conjugation efficiency by several orders of magnitude, demonstrating its essential nature in the HGT process .

What is the relationship between TrbD and other conjugal transfer proteins in the Trb family?

TrbD functions in concert with other Trb proteins (including TrbC, TrbF, TrbI, TrbJ, and TrbL) to form the mating pair formation (Mpf) complex required for conjugative transfer. These proteins interact in a highly coordinated manner to assemble the conjugation apparatus. Research indicates that TrbD works particularly closely with TrbC and TrbF in pilus formation and stability .

What are the recommended methods for expressing and purifying recombinant TrbD protein?

Expression and purification of recombinant TrbD protein can be achieved using established protocols adapted for membrane-associated proteins. Based on approaches used for similar proteins in Rhizobium, the following methodology is recommended:

  • Expression system selection: The E. coli BL21(DE3) strain is ideal for TrbD expression when combined with a T7 promoter-driven expression vector containing a 6x-His tag fusion for purification .

  • Culture conditions: Grow transformed cells at 37°C in 2TY medium (1.6% tryptone, 1.0% yeast extract, 5.0% NaCl) supplemented with appropriate antibiotics. Induce protein expression with 0.1 mM IPTG when cultures reach mid-log phase (OD600 = 0.6-0.8) .

  • Cell lysis and membrane fraction isolation: Harvest cells 6 hours post-induction, resuspend in buffer (typically 50 mM Tris-HCl pH 8.0, 150 mM NaCl) containing protease inhibitors, and lyse using sonication or pressure-based methods. Isolate membrane fractions through differential centrifugation .

  • Protein solubilization: Solubilize membrane-bound TrbD using mild detergents such as n-dodecyl-β-D-maltoside (DDM) at 1% concentration.

  • Affinity purification: Purify the His-tagged TrbD using nickel affinity chromatography, followed by size exclusion chromatography to enhance purity.

Protein purity should be assessed by SDS-PAGE and Western blotting using anti-His antibodies. Typical yields range from 1-5 mg of purified protein per liter of bacterial culture, with purity exceeding 90% after the two-step purification process.

How can researchers create and validate TrbD deletion mutants in Rhizobium species?

Creating and validating TrbD deletion mutants requires a systematic approach to ensure complete removal of gene function while maintaining plasmid integrity. The following methodology is recommended:

  • Deletion strategy design: Employ precise gene deletion using homologous recombination or CRISPR/Cas9-based approaches rather than transposon mutagenesis to avoid polar effects on adjacent genes .

  • Construction of deletion vectors: Design vectors containing homologous sequences flanking the trbD gene with a selectable marker (e.g., antibiotic resistance) between them. For conjugative plasmids like pTA-Mob 2.0, introduce these modifications while maintaining the plasmid backbone .

  • Selection of mutants: Transform the deletion construct into E. coli hosts harboring the target plasmid, and select transformants on appropriate antibiotics.

  • Validation of deletion:

    • PCR verification using primers flanking the deletion site

    • Sequencing to confirm precise junction formation

    • Western blot analysis to verify absence of TrbD protein

    • Phenotypic confirmation through conjugation efficiency assays

  • Complementation testing: Create a complementation plasmid containing the intact trbD gene under an inducible promoter (e.g., arabinose-inducible PBAD) for trans complementation experiments .

Validation should demonstrate:

  • Complete absence of trbD gene and protein in the mutant

  • Severely reduced conjugation efficiency (typically 4-5 logs lower than wild-type)

  • Restoration of conjugation upon complementation with the intact gene

This approach ensures that the observed phenotypes are specifically attributed to trbD deletion rather than polar effects or secondary mutations.

What techniques are effective for studying TrbD protein-protein interactions in the conjugation apparatus?

Investigating TrbD interactions with other components of the conjugation apparatus requires specialized techniques appropriate for membrane-associated protein complexes. The following methodological approaches are recommended:

  • Bacterial two-hybrid (B2H) screening: This in vivo approach is suitable for initial identification of potential interaction partners. By fusing TrbD and candidate partners to complementary fragments of adenylate cyclase or similar reporter systems, interactions can be detected through reporter gene activation. This technique is particularly useful for screening interactions between TrbD and other Trb proteins (TrbC, TrbF, TrbI, etc.) .

  • Co-immunoprecipitation (Co-IP): For validating interactions identified through screening, Co-IP using epitope-tagged versions of TrbD can capture protein complexes from bacterial lysates. This technique requires:

    • Expression of tagged TrbD in Rhizobium or heterologous hosts

    • Careful membrane solubilization with appropriate detergents

    • Immunoprecipitation with anti-tag antibodies

    • Western blot analysis to identify co-precipitated proteins

  • Förster Resonance Energy Transfer (FRET): For studying interactions in living cells, FRET microscopy using fluorescently tagged TrbD and partner proteins can detect proximity-based energy transfer.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry analysis can identify interaction interfaces between TrbD and other proteins at amino acid resolution.

  • Complementation analysis with chimeric proteins: Creating domain-swapped variants of TrbD with homologous proteins can identify functional interaction domains based on restored conjugation efficiency.

These techniques should be employed in combination to build a comprehensive interaction map of TrbD within the conjugation apparatus, with validation across multiple methods increasing confidence in the identified interactions.

How does the structure of TrbD contribute to its function in conjugative transfer?

While the complete three-dimensional structure of TrbD has not been fully resolved, structural predictions and functional studies suggest a topology similar to other Trb proteins involved in T4SS assembly. The protein is expected to contain transmembrane domains that anchor it in the bacterial inner membrane, with additional domains extending into the periplasmic space to interact with other components of the conjugation machinery.

To understand structure-function relationships of TrbD, researchers should consider the following methodological approaches:

  • Structural prediction and modeling: Employ computational approaches including homology modeling based on structurally characterized homologs, ab initio modeling, and molecular dynamics simulations to predict TrbD structure.

  • Domain mapping through targeted mutagenesis: Create a series of site-directed mutants targeting conserved residues or predicted functional domains, then assess their effects on conjugation efficiency. The following table outlines a systematic approach to domain analysis:

  • Cryo-electron microscopy: For structural determination of the entire conjugation apparatus, including TrbD, cryo-EM of purified complexes can provide insights into the protein's position and interactions within the machinery.

The functional significance of structural elements should be validated through complementation assays with mutant variants in trbD deletion backgrounds, measuring conjugation efficiency as the primary readout .

What role does TrbD play in the regulation of conjugative transfer under different environmental conditions?

TrbD's involvement in conjugative transfer may be subject to environmental regulation, particularly as horizontal gene transfer is often conditionally advantageous. Understanding this regulation requires systematic investigation of conjugation efficiency under various conditions:

  • Transcriptional regulation: Analyze trbD expression patterns using reporter fusions (lacZ, gfp) under different environmental conditions including:

    • Nutrient limitation (C, N, P sources)

    • pH variations (acidic vs. alkaline)

    • Temperature shifts

    • Oxygen availability

    • Plant root exudate exposure

    • Population density variations

  • Post-translational regulation: Investigate potential modifications of TrbD using:

    • Phosphorylation state analysis via Phos-tag gels or MS/MS

    • Bacterial two-hybrid screens with regulatory proteins

    • Co-immunoprecipitation studies under varying conditions

  • Integration with global regulatory networks: Examine trbD expression and conjugation efficiency in regulatory mutant backgrounds (e.g., quorum sensing, stress response regulators).

Research indicates that genes associated with conjugation machinery, including trb genes, show differential expression across growth phases and environmental conditions. For example, in Rhizobium species, expression patterns change significantly during symbiotic interactions with host plants, suggesting environmental modulation of conjugation systems . Methodologically, researchers should employ both controlled laboratory conditions and more naturalistic settings (e.g., rhizosphere models) to fully understand the environmental regulation of TrbD function.

How do mutations in TrbD affect the fitness and evolutionary trajectory of Rhizobium populations?

Mutations in conjugation machinery genes like trbD can significantly impact bacterial population dynamics and evolution by altering horizontal gene transfer rates. Investigating these effects requires evolutionary and population genetics approaches:

  • Experimental evolution: Compare the evolutionary trajectories of wild-type and trbD mutant Rhizobium populations over hundreds of generations under various selection pressures. Key parameters to measure include:

    • Adaptation rates to novel environments

    • Fixation of beneficial mutations

    • Population genetic diversity

    • Genome structural variation

  • Competitive fitness assays: Directly measure relative fitness of trbD mutants vs. wild-type strains in mixed cultures under various conditions, using fluorescent markers or unique sequence tags to distinguish lineages.

  • Population genomic analysis: Sequence evolved populations to quantify:

    • Rates of beneficial mutation accumulation

    • Patterns of nucleotide diversity (π)

    • Selection efficacy (dN/dS ratios)

    • Linkage disequilibrium patterns

Recent research has demonstrated that recombination significantly increases the proportion of amino acid substitutions fixed by adaptive evolution (α) in Rhizobium species, with α ranging from 0.07 to 0.39 across species . Higher recombination rates correlate with both increased fixation of advantageous variants and decreased fixation of deleterious variants. Conjugation machinery directly facilitates this recombination, suggesting that trbD mutations would reduce recombination rates and potentially impair adaptive evolution .

The methodological approach should involve long-term evolution experiments with isogenic strains differing only in trbD status, followed by comprehensive genomic and phenotypic analysis to determine how altered conjugation capacity affects evolutionary outcomes.

How can TrbD be engineered to create inducible conjugation systems for controlled horizontal gene transfer?

Engineering inducible conjugation systems through TrbD modification represents a promising approach for controlled horizontal gene transfer. This strategy offers applications in synthetic biology, directed evolution, and biocontainment. The following methodological framework is recommended:

  • Promoter replacement strategy: Replace the native trbD promoter with tightly regulated inducible promoters. Based on existing research with conjugative systems, the arabinose-inducible PBAD promoter has demonstrated efficacy in controlling conjugation genes . Alternative inducible systems to consider include:

    • Tetracycline-responsive promoters (Ptet)

    • IPTG-inducible promoters (Plac, Ptac)

    • Rhamnose-inducible promoters (PrhaBAD)

  • Gene deletion with complementation: Create a trbD deletion in the conjugative plasmid and provide the gene in trans under inducible control. Research has shown that this approach can achieve up to 5-log differences in conjugation efficiency between induced and uninduced conditions .

  • Protein destabilization approach: Engineer TrbD with degron tags that respond to small molecules, allowing post-translational control of protein stability.

  • Performance evaluation: Assess system performance using the following metrics:

    • Conjugation efficiency (transconjugants per donor)

    • Induction ratio (induced/uninduced conjugation rates)

    • System leakiness under uninduced conditions

    • Kinetics of conjugation activation after induction

    • Host range of the engineered system

Conjugation SystemUninduced Conjugation EfficiencyInduced Conjugation EfficiencyInduction Ratio
Wild-type pTA-Mob 2.0~10^-3 - 10^-2~10^-3 - 10^-21
ΔtrbD + inducible trbD~10^-7 - 10^-6~10^-3 - 10^-2~10^4

These systems provide valuable tools for applications requiring precise control over horizontal gene transfer while maintaining biocontainment .

What are the implications of TrbD research for understanding host-symbiont interactions in Rhizobium-legume symbiosis?

TrbD research offers significant insights into the molecular mechanisms underlying Rhizobium-legume symbiosis, particularly regarding genetic exchange and adaptation during symbiotic establishment. Methodological approaches to investigate these implications include:

  • Temporal expression analysis: Monitor trbD expression throughout symbiotic development using:

    • Transcriptomics (RNA-seq) of bacteria during different symbiotic stages

    • Reporter gene fusions (gfp, lux) to visualize expression in planta

    • RT-qPCR for targeted expression quantification

  • Functional importance in symbiosis: Evaluate how trbD mutants affect symbiotic outcomes through:

    • Nodulation assays (nodule number, development, morphology)

    • Nitrogen fixation measurements (acetylene reduction assay)

    • Microscopy of bacteroid development and persistence

    • Plant growth parameters under nitrogen-limiting conditions

  • Horizontal gene transfer during symbiosis: Investigate conjugation events in the rhizosphere and within nodules using:

    • Marker exchange experiments with selectable plasmids

    • Metagenomic analysis of nodule bacteria over time

    • Fluorescent labeling of conjugative plasmids for in situ visualization

Research on related Rhizobium proteins has shown that certain surface proteins adopt amyloid states during symbiotic interactions . While trbD itself hasn't been directly implicated in this process, conjugation machinery components may contribute to bacterial adaptation during symbiosis. For instance, the expression of certain membrane proteins changes dramatically during nodulation, suggesting regulatory links between symbiotic processes and bacterial surface structures .

The implication of this research is that conjugation machinery, including TrbD, may facilitate genetic exchange within the rhizosphere community, potentially enhancing symbiotic adaptability through increased genetic diversity and horizontal acquisition of beneficial traits.

How can structural insights about TrbD inform the development of inhibitors targeting bacterial conjugation systems?

Targeting conjugation machinery with specific inhibitors represents a novel approach to limiting antimicrobial resistance spread. Structural insights about TrbD can inform rational inhibitor design through the following research methodology:

  • Structure-based drug design: Utilizing structural data (experimental or predicted) to identify potential binding pockets within TrbD that could accommodate small molecule inhibitors. Key approaches include:

    • In silico screening of compound libraries against TrbD models

    • Fragment-based design targeting conserved functional domains

    • Peptide mimetics that disrupt TrbD-protein interactions

  • High-throughput screening: Develop assays to identify compounds that specifically inhibit TrbD function, such as:

    • Conjugation efficiency assays with fluorescent readouts

    • Protein-protein interaction disruption assays

    • TrbD conformational change detection systems

  • Mechanism of action studies: For promising inhibitor candidates, determine whether they:

    • Prevent TrbD assembly into the conjugation complex

    • Block specific protein-protein interactions

    • Interfere with conformational changes

    • Destabilize the protein structure

  • Specificity assessment: Evaluate inhibitor specificity through:

    • Activity testing against related conjugation systems

    • Effects on homologous proteins in beneficial bacteria

    • Impact on host cell processes

  • Efficacy validation: Test inhibitors for their ability to:

    • Reduce plasmid transfer rates in laboratory conditions

    • Prevent resistance spread in simulated environments

    • Maintain activity in relevant biological matrices

The potential impact of such inhibitors extends beyond antimicrobial resistance control to applications in biocontainment of engineered organisms and selective modulation of microbiome composition. By targeting specific components like TrbD rather than broadly inhibiting bacterial growth, these approaches could offer more precise interventions with fewer ecological side effects.

What emerging technologies could advance our understanding of TrbD dynamics during the conjugation process?

Emerging technologies offer unprecedented opportunities to study TrbD dynamics during conjugation at high spatiotemporal resolution. The following methodological approaches represent cutting-edge techniques that could transform our understanding of this process:

  • Super-resolution microscopy: Techniques such as PALM, STORM, or STED microscopy can visualize TrbD localization and dynamics within bacterial cells at nanometer resolution. By labeling TrbD with photoactivatable fluorescent proteins or appropriate dyes, researchers can track:

    • Spatial organization before and during conjugation

    • Assembly dynamics of the conjugation apparatus

    • TrbD clustering patterns and mobility

  • Live-cell single-molecule tracking: Using techniques like single-particle tracking PALM (sptPALM), researchers can follow individual TrbD molecules in living cells to determine:

    • Diffusion coefficients in different cellular compartments

    • Residence times at conjugation sites

    • Association/dissociation kinetics with other proteins

  • Cryo-electron tomography: This technique can visualize entire conjugation machinery in a near-native state, revealing:

    • TrbD positioning within the intact complex

    • Structural rearrangements during conjugation

    • Interactions with membrane components

  • Mass spectrometry-based interactomics: Advanced techniques such as proximity labeling (BioID, APEX) combined with quantitative proteomics can identify:

    • Temporal changes in TrbD interaction partners

    • Weak or transient interactions missed by traditional approaches

    • Post-translational modifications during conjugation

  • Microfluidics-based single-cell analysis: Custom microfluidic devices can enable:

    • Real-time visualization of conjugation events

    • Correlation of TrbD dynamics with DNA transfer

    • Precise manipulation of environmental conditions

  • CRISPR-based genetic screens: These approaches can systematically identify genetic factors affecting TrbD function through:

    • Genome-wide screens for conjugation efficiency modulators

    • Targeted mutagenesis of trbD to create functional variants

    • CRISPRi/a systems for dynamic control of expression

Implementation of these technologies will require interdisciplinary collaboration between microbiologists, structural biologists, biophysicists, and computational scientists, but holds promise for revolutionizing our understanding of TrbD's dynamic role in bacterial conjugation.

How might comparative genomics of TrbD across diverse bacterial species inform evolutionary understanding of conjugation systems?

Comparative genomics approaches offer powerful insights into the evolution and diversification of conjugation systems across bacterial lineages. A comprehensive research methodology should include:

  • Phylogenetic analysis: Construct robust phylogenetic trees of TrbD homologs across diverse bacterial phyla to:

    • Identify major evolutionary lineages

    • Detect horizontal transfer events between distant taxa

    • Map the emergence of functional variants

  • Sequence conservation analysis: Perform multiple sequence alignments to identify:

    • Universally conserved residues indicating essential function

    • Lineage-specific variations suggesting functional adaptations

    • Co-evolving residues suggesting functional coupling

  • Synteny analysis: Examine the genomic context of trbD across species to understand:

    • Conservation of operon structure

    • Co-evolution with other conjugation genes

    • Acquisition of novel genetic elements

  • Selection pressure analysis: Calculate dN/dS ratios to determine:

    • Regions under purifying selection (functional constraints)

    • Sites under positive selection (functional adaptation)

    • Shifts in selection pressure across lineages

  • Structure-function predictions: Map sequence variations onto structural models to:

    • Predict functional consequences of evolutionary changes

    • Identify potential host-specific adaptations

    • Guide experimental verification of key residues

Research on related conjugation systems has shown that homologous recombination significantly impacts adaptive evolution in bacteria, with the proportion of amino acid substitutions fixed by adaptive evolution (α) varying from 0.07 to 0.39 across Rhizobium species . This suggests that conjugation machinery itself may be subject to adaptive pressures, potentially linked to host range, environmental conditions, or compatibility with different genetic elements.

The methodological approach should combine comprehensive database mining with targeted experimental validation of evolutionary predictions, using experimental systems to test how sequence variations in TrbD affect conjugation efficiency across different ecological contexts.

What are the potential applications of TrbD-based systems in synthetic biology and bioengineering?

TrbD-based conjugation systems offer versatile platforms for synthetic biology applications, particularly for controlled genetic material transfer between cells. The following methodological framework outlines key approaches for leveraging these systems:

  • Engineered microbial consortia: Develop TrbD-based systems to facilitate programmed genetic exchange within bacterial communities for applications such as:

    • Division of metabolic labor across specialized strains

    • Sequential processing of complex substrates

    • Coordinated biosynthesis of valuable compounds

    • Spatiotemporal control of gene expression within biofilms

  • Targeted DNA delivery vehicles: Engineer TrbD-containing conjugation systems as precision tools for genetic modification by:

    • Adapting host specificity through receptor recognition modifications

    • Incorporating cargo-specific selection mechanisms

    • Developing tissue-targeting capabilities for in vivo applications

    • Creating systems with programmable transfer initiation

  • Biocontainment strategies: Exploit the inducibility of TrbD-based systems to create:

    • Conditional conjugation dependent on environmental signals

    • Self-limiting genetic transfer systems

    • Kill switches linked to unauthorized conjugation events

  • Directed evolution platforms: Develop TrbD-based systems to facilitate accelerated evolution through:

    • Controlled horizontal gene transfer between evolving populations

    • Conjugation-linked mutagenesis systems

    • Selection-coupled genetic exchange mechanisms

Research has demonstrated that engineering conjugative systems with inducible control of essential components like trbD can achieve up to 5-log differences in conjugation efficiency . This level of control makes these systems attractive for applications requiring precise regulation of horizontal gene transfer.

A systematic implementation strategy should include:

  • Characterization of system parameters (efficiency, host range, cargo capacity)

  • Development of standardized genetic parts compatible with conjugation machinery

  • Creation of mathematical models predicting system behavior

  • Validation in increasingly complex environments

These approaches could establish TrbD-based conjugation systems as valuable tools in the synthetic biology toolkit, enabling novel approaches to challenges in biotechnology, biomedicine, and environmental engineering.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.