Recombinant Rhizobium sp. Probable conjugal transfer protein trbF (trbF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: Tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development to meet your specifications.
Synonyms
trbF; NGR_a04130; y4dD; Probable conjugal transfer protein TrbF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-220
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
trbF
Target Protein Sequence
MAANRAPENPYLAARQEWTERYGSYVRAAAAWRTVGILGLAMAVIGFGYAMYLSTEVKLV PYIVQVDKLGTSVTTGFPEQIEYADVRVVRATLGNFVTSFRSITPDAAVQKQYIDRTYVL LRTSDPSTEKINAWFRGNSPFEKAKTATVAIEVNNIVALSNQTYQIDWTEYERDRKGKEI GTRRFRGIATVTLTAPQDEATIRLNPIGLYVRDFDWTAQL
Uniprot No.

Target Background

Database Links
Protein Families
TrbF family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the function of trbF in Rhizobium species?

trbF is an essential component of the bacterial conjugation machinery in Rhizobium species. It belongs to the trb operon, which encodes proteins necessary for the formation of mating bridges across which DNA is transferred during conjugation . The trbF protein is part of the polycistronic Tra2 region that encodes the surface apparatus responsible for promoting conjugative transfer . Specifically, trbF is one of the extremely hydrophobic proteins that likely contains membrane-spanning domains and is involved in the assembly of the mating pair apparatus . Mutational analysis has confirmed that trbF is essential for conjugative transfer between bacterial strains .

How does trbF fit into the broader conjugative transfer system?

The conjugative transfer system in Rhizobium species consists of two main regions: Tra1 and Tra2. While Tra1 primarily encodes DNA processing functions for generating the single-stranded DNA molecule that is transferred, the Tra2 region (which includes trbF) forms part of the Mating Pair Formation (Mpf) system . This system forms a membrane-spanning transfer apparatus that facilitates protein and DNA transport between bacterial cells . Three major components are required for conjugative transfer:

  • The relaxosome (formed by TraH, TraI, TraJ, and TraK proteins at the transfer origin)

  • The Mpf system (including trbF)

  • TraG, which connects the relaxosome and the Mpf complex

Is trbF conserved across different Rhizobium species?

Yes, trbF is widely conserved throughout RepABC plasmids carried by Rhizobiaceae . Sequence analysis has shown that the trb regions required for conjugal transfer are virtually identical in different types of Ti plasmids, such as octopine type plasmid pTi15955 and nopaline/agrocipine type plasmid pTiC58 . This conservation extends to symbiosis plasmids found in other Rhizobium species, suggesting that essentially the same transfer system is present across the genus .

What approaches are effective for studying trbF function through mutagenesis?

To study trbF function through mutagenesis, researchers have successfully employed the following approaches:

  • Gene deletion and complementation: Creating precise deletions of the trbF gene followed by trans-complementation with an inducible promoter system. For example, researchers have used the arabinose-inducible pBAD promoter to control trbF expression . This approach allows for conditional restoration of conjugation functionality.

  • Experimental design for complementation studies:

    • Create a deletion plasmid lacking the trbF gene

    • Develop a complementation plasmid expressing trbF under control of an inducible promoter

    • Transform both plasmids into donor strains

    • Test conjugation under induced and repressed conditions

    • Include appropriate controls with wild-type plasmids

Table 1: Example results from trbF complementation experiments

ConditionConjugation ObservedTransconjugants Produced
Induced (arabinose added)YesHigh numbers
Repressed (glucose added)NoNone
Uninduced (no addition)NoNone
Wild-type controlYesHighest numbers

How can I verify successful expression of recombinant trbF protein?

Verification of recombinant trbF expression can be accomplished through several complementary techniques:

  • Western blotting: Using antibodies specific to trbF or to an affinity tag if one has been added to the recombinant protein.

  • Functional complementation assays: Testing whether the recombinant protein can restore conjugation ability in a trbF deletion mutant.

  • Mass spectrometry: For precise identification and characterization of the expressed protein.

  • Fluorescence microscopy with GFP fusion proteins: Creating a trbF-GFP fusion protein allows visualization of the protein's localization within bacterial cells. This approach has been successful for tracking other proteins in rhizobia . The pHC60 vector encoding tetracycline resistance with a constitutively expressed GFP gene has been effectively used in similar studies .

What are reliable methods for isolating functional trbF protein?

When isolating functional trbF protein, consider the following methodology:

  • Expression system selection: Due to the hydrophobic nature of trbF, which contains membrane-spanning domains , specialized expression systems designed for membrane proteins may be necessary.

  • Buffer optimization: Use Tris-based buffers with 50% glycerol as described in commercial preparations .

  • Purification approach:

    • Use affinity chromatography with an appropriate tag (His-tag is commonly used)

    • Consider including detergents to solubilize membrane proteins

    • Perform size exclusion chromatography as a secondary purification step

    • Store aliquots at -20°C to -80°C to maintain stability

    • Avoid repeated freeze-thaw cycles

How can trbF be leveraged for engineering controlled horizontal gene transfer systems?

trbF has proven valuable for developing inducible conjugation systems that allow for controlled horizontal gene transfer . The research demonstrates:

How does trbF contribute to plasmid dissemination in soil microbiomes?

The trbF protein plays a crucial role in the genetic exchange observed in soil microbiomes:

  • Evidence of horizontal gene transfer: Studies of soil populations of Rhizobium leguminosarum bv. trifolii isolates have shown clear evidence of genetic exchange of symbiotic (Sym) plasmids . The same Sym plasmids were found in unrelated strains, and unrelated Sym plasmids were observed in identical host strains .

  • In vivo recombination: Hybridization patterns suggest that in vivo recombination of different plasmids occurs in soil environments .

  • Ecological significance: The ability of rhizobia to transfer plasmids is ecologically significant as it allows for:

    • Adaptation to new hosts

    • Acquisition of beneficial traits

    • Dissemination of symbiotic capability among soil bacteria

  • Methodological approach for studying plasmid transfer in soil:

    • Isolate soil bacteria and characterize using DNA hybridization probes

    • Use plasmid-specific markers to track transfer events

    • Employ serological techniques to establish bacterial lineages

    • Correlate plasmid profiles with symbiotic effectiveness

What is the relationship between trbF function and regulatory networks in Rhizobium?

Recent research has revealed complex regulatory relationships involving conjugative transfer proteins including trbF:

  • Integration with quorum sensing: trbF expression is regulated by quorum sensing systems. Overproduction of certain small RNAs (sRNAs) like QfsR has been shown to increase "quorum sensing signal accumulation and the Ti plasmid conjugative transfer" .

  • Regulatory hub: The trbF gene appears to be part of a regulatory network connecting "motility, succinoglycan biosynthesis and plasmid conjugative transfer" .

  • Feedforward control: Some sRNAs, such as QfsR, bind to trbK mRNA (another conjugation-related gene) and "exert a feedforward control on the regulation of motility" that "may allow pTi dissemination by conjugation" .

  • Experimental approach to study regulation:

    • Generate strains with altered expression of regulatory elements

    • Measure conjugation frequencies under various conditions

    • Use transcriptional reporters to monitor gene expression

    • Identify direct binding partners through RNA-protein interaction studies

How should I interpret contradictory findings when studying trbF function?

When facing contradictory data regarding trbF function, consider the following analytical approach:

  • Thoroughly examine the data: Identify specific discrepancies and patterns that contradict your initial hypothesis. Pay special attention to outliers that may have influenced the results .

  • Evaluate initial assumptions: Reassess your research design and the assumptions underlying your hypothesis .

  • Consider alternative explanations:

    • Strain-specific variations in trbF structure or function

    • Environmental conditions affecting conjugation efficiency

    • Interactions with other conjugation system components

    • Technical issues with the experimental setup

  • Take methodological steps:

    • Replicate experiments under various conditions

    • Use multiple complementary techniques to verify results

    • Include appropriate positive and negative controls

    • Consult literature for similar contradictions and their resolutions

  • Approach with an open mind: "Unexpected findings can lead to new discoveries and avenues for further investigation" .

What factors affect trbF expression and function in experimental settings?

Several factors can influence trbF expression and function in laboratory experiments:

  • Expression level factors:

    • Promoter strength: trbF may require "significantly higher expression levels to fully restore conjugative functions"

    • Basal expression: Low basal expression from leaky promoters "may be insufficient to rescue the phenotype"

    • Expression timing: Conjugation genes may need coordinated expression

  • Environmental conditions:

    • Presence of inducing compounds like opines or flavonoids

    • Bacterial density reaching critical points

    • Growth phase and metabolic state of bacteria

  • Genetic context:

    • Impact of "altered expression of genes surrounding trbF"

    • Interactions with other components of the conjugation machinery

    • Strain-specific genetic backgrounds

  • Technical considerations:

    • Plasmid copy number effects

    • Stability of expression constructs

    • Selection markers and their effects on bacterial physiology

How can I determine if variations in my trbF sequence affect protein function?

To assess the functional impact of trbF sequence variations:

  • Sequence analysis approach:

    • Align your trbF sequence with reference sequences from well-characterized strains

    • Identify conserved domains and motifs essential for function

    • Use structural prediction tools to assess potential impacts on protein folding

  • Functional complementation testing:

    • Introduce your variant trbF sequence into a trbF deletion strain

    • Measure conjugation efficiency compared to wild-type complementation

    • Test under various conditions to identify conditional phenotypes

  • Structure-function analysis:

    • Create targeted mutations in conserved regions

    • Perform domain swapping with functional homologs

    • Use protein modeling to predict interaction surfaces

  • Evolutionary perspective:

    • Compare with trbF sequences from diverse Rhizobium species

    • Identify regions under purifying selection (highly conserved)

    • Correlate sequence variations with host range or transfer efficiency

What are emerging applications of trbF in synthetic biology?

The trbF protein holds significant potential for synthetic biology applications:

  • Programmable gene transfer systems: Further refinement of inducible conjugation systems based on trbF could enable precise control over horizontal gene transfer .

  • Biocontainment strategies: Engineered dependence on specific inducers for conjugation provides a safety mechanism for genetically modified organisms.

  • Modular conjugation machinery: Components like trbF could be used as building blocks for synthetic conjugation systems with novel properties.

  • Methodological approach for synthetic biology applications:

    • Characterize minimal components needed for functional conjugation systems

    • Develop standardized genetic parts based on trbF and related proteins

    • Create libraries of variants with different induction properties

    • Test in diverse host backgrounds to ensure broad applicability

How might trbF research contribute to understanding plant-microbe interactions?

Research on trbF has implications for understanding and improving plant-microbe interactions:

  • Horizontal gene transfer in rhizosphere: trbF-mediated conjugation contributes to genetic exchange that shapes rhizobial communities in the soil and rhizosphere .

  • Symbiotic efficiency: Plasmid transfer mediated by conjugation systems that include trbF can affect "symbiotic effectiveness" on host plants . Research shows that "the pattern of response was similar within groupings on the basis of Sym plasmid and chromosomal profiles but different between such groups" .

  • Endophytic colonization: Rhizobia, including species that possess trbF, can form "natural endophytic associations with roots of important cereal plants" . These associations can enhance plant growth and development.

  • Experimental approaches:

    • Study conjugation frequencies in the rhizosphere versus bulk soil

    • Track plasmid transfer in planta using fluorescent markers

    • Assess the impact of trbF mutations on endophytic colonization

    • Investigate horizontal transfer of beneficial traits to non-symbiotic bacteria

What technological advances could enhance our ability to study trbF?

Future technological developments likely to advance trbF research include:

  • Advanced imaging techniques: New microscopy methods could allow real-time visualization of conjugation events and trbF localization in living cells.

  • High-throughput mutagenesis: Approaches like CRISPR-Cas systems could facilitate rapid creation of trbF variants to map structure-function relationships.

  • Single-cell technologies: Methods to study conjugation at the single-cell level would provide insights into cell-to-cell variability in conjugation efficiency.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics could reveal how trbF expression is coordinated with other cellular processes.

  • Methodological considerations for future studies:

    • Design experiments that leverage new technologies while maintaining rigor

    • Develop standardized assays for comparing results across different studies

    • Establish community resources for sharing plasmids, strains, and protocols

    • Implement robust statistical frameworks for analyzing complex datasets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.