Recombinant Rhizobium sp. Probable conjugal transfer protein trbI (trbI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
trbI; NGR_a04100; y4dG; Probable conjugal transfer protein TrbI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-431
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
trbI
Target Protein Sequence
MVQSLRLGAANEAEDQNGMRRLNRLPIIVAIVIVALFVGFVVIGLAWRGLPFNRNNDIHS ASNTPATNFGDQLKRGVTDGIIGEPVKREAFQPTPTMKQKVDKEPTVVDRPTEPEERRPR LETEEEWKARLMREQDEQIIREAQRQRMARLQARATALDSPLKVDISEGEKAPKNSTDTG QNPTATENNASDLYPAAMKSGIMGENLDPNAQASKEDFFNQDIKDDGYLPNRVVPQMSVY ELKRGSVIPATLITGLNSDLPGRITAQVSQNVYDSATGYRLLIPQGAKLFGRYDSKVSFG QERVLVVWTDLIFPNGSTLQIGGMAGTDAEGYGGFKDRVDRHLWRTWSSAALIALIGTGI DMSMPESSTLATQDTASDAVRRNFAESFGRVAEQTISKNLNVQPTIRIRPGYKFNVLVDQ DIIFPSAYRDN
Uniprot No.

Target Background

Database Links
Protein Families
TrbI/VirB10 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structure and function of Recombinant Rhizobium sp. Probable conjugal transfer protein trbI?

Recombinant Rhizobium sp. Probable conjugal transfer protein trbI is a protein derived from Rhizobium sp. (strain NGR234) that functions as part of the bacterial conjugation machinery. The protein consists of 431 amino acids and is encoded by the trbI gene located on plasmids in Rhizobium species . The amino acid sequence contains hydrophobic regions suggesting transmembrane domains that likely anchor the protein in the bacterial membrane, forming part of the conjugation channel. The trbI protein serves as a component of the mating pair formation (Mpf) machinery which creates a physical connection between donor and recipient cells during bacterial conjugation . This connection enables the transfer of DNA, particularly large symbiotic plasmids (pSyms) containing genes for nodulation and nitrogen fixation. Studies have shown that mutations in trbI and related genes can significantly reduce or eliminate the conjugative transfer ability of plasmids in rhizobia, highlighting its essential role in this process .

How does trbI contribute to the evolution of rhizobial species?

The trbI protein plays a significant role in the evolution of rhizobial species through its function in conjugative plasmid transfer. Conjugation serves as a primary mechanism for horizontal gene transfer in bacteria, allowing for the spread of adaptive traits across populations. In rhizobia, the transfer of symbiotic plasmids (pSyms) that contain nodulation and nitrogen fixation genes can transform non-symbiotic bacteria into symbiotic ones capable of forming nodules on legume plants . The presence of conjugation systems containing trbI has been observed across different rhizobial species, suggesting evolutionary conservation of these transfer mechanisms .

Genomic analyses have revealed that conjugative transfer genes can be found on both symbiotic plasmids and non-symbiotic plasmids, indicating that the ability to transfer genetic material is widespread in rhizobia . The distribution patterns of these genes suggest that conjugation has shaped the genomic architecture of rhizobial species throughout their evolutionary history. This genetic exchange contributes to adaptation to different host plants and environmental conditions, as evidenced by studies showing acquisition of not only symbiotic capabilities but also improved saprophytic competence, such as prototrophy for certain vitamins .

What are the different types of conjugation systems in rhizobia and where does trbI fit?

Research has identified at least three distinct types of conjugation systems in rhizobia, each with different regulatory mechanisms and genetic components . The trbI protein can be found in these different systems, with its specific regulatory context and functional partners varying between systems:

  • Quorum sensing (QS)-regulated conjugation system (Type I): This system is regulated by bacterial population density through quorum sensing mechanisms. The expression of transfer genes increases when the bacterial population reaches a certain threshold, enabling efficient conjugation at high cell densities .

  • RctA-repressed conjugation system (Type II): In this system, a repressor protein called RctA inhibits the transcription of conjugation genes, including operons containing genes related to trbI. Research using DNase I footprinting has demonstrated that RctA binds to a 9-bp motif in the spacer region of the virB operon promoter . This interaction inhibits RNA polymerase access to the promoter, preventing transcription of conjugation genes. The repression is relieved under certain conditions, allowing plasmid transfer to occur.

  • A third type of conjugation system (Type III): This less characterized system has been identified in plasmids such as pRleVF39c in Rhizobium leguminosarum bv. viciae strain VF39SM . It contains unique genetic components that distinguish it from the other two types.

Understanding these differences is crucial for comprehending the diversity of conjugative transfer mechanisms in rhizobia and their regulation in different environmental contexts.

What techniques are used to study trbI function in laboratory settings?

Several methodological approaches are employed to study the function of trbI in laboratory settings:

  • Mutagenesis: Researchers create targeted mutations in the trbI gene to analyze the resulting phenotypes, particularly changes in conjugative transfer efficiency. This can involve deletion mutations, point mutations, or insertional inactivation using antibiotic resistance markers .

  • Conjugation assays: The functional impact of trbI on plasmid transfer is typically assessed through conjugation experiments, where the frequency of plasmid transfer (measured as transconjugants per recipient cell) is determined with wild-type versus mutant trbI . These assays involve mixing donor and recipient bacterial strains, allowing them to mate, and then selecting for transconjugants using appropriate antibiotics.

  • Transcriptional fusion analyses: To study the regulation of trbI expression, researchers create fusions between the trbI promoter region and reporter genes like lacZ or gfp. This allows the visualization and quantification of gene expression under different conditions or in different genetic backgrounds .

  • DNase I footprinting and binding assays: These techniques are used to identify specific DNA-binding interactions between regulatory proteins and the promoter regions controlling trbI expression, helping to elucidate regulatory mechanisms .

  • Recombinant protein production: For biochemical and structural studies, the trbI protein is produced as a recombinant protein in expression systems, purified, and then subjected to various analyses to determine its properties and interactions .

  • Origin of transfer (oriT) identification: Cloning approaches can be used to identify origins of transfer within the replicons, which are essential for conjugative transfer. This helps in understanding the complete machinery involved in the conjugation process .

How do regulatory mechanisms control trbI expression and function in different rhizobial species?

The expression and function of trbI in rhizobial species are subject to sophisticated regulatory mechanisms that ensure conjugative transfer occurs under appropriate conditions. Different regulatory systems have been identified, highlighting the complex control of conjugal transfer in rhizobia:

In the RctA-repressed conjugation system (Type II), the RctA protein acts as a transcriptional repressor that binds specifically to the promoter region of transfer genes, including those in operons containing trbI . Research using DNase I footprinting has demonstrated that RctA binds to a 9-bp motif in the spacer region of the virB operon promoter, with this binding requiring a functional -10 region . This interaction prevents RNA polymerase from accessing the promoter, thereby inhibiting transcription of conjugation genes.

Regulatory complexity is further increased through transcriptional interference. Studies have shown that transcripts emanating from the virB promoter can modulate rctA expression levels through a mechanism called transcriptional interference . This creates a feedback loop where the repressor and the genes it represses influence each other's expression. In this system, another gene, rctB, located downstream of traA, appears to act as an inhibitor of the repressor activity of rctA, adding another layer of regulation .

In contrast, the quorum sensing-regulated conjugation system (Type I) relies on population density signals to control transfer gene expression . When bacterial population density reaches a threshold, accumulated signal molecules activate transcriptional regulators that induce the expression of conjugation genes. This ensures that conjugation occurs preferentially in dense bacterial communities where the probability of finding recipient cells is higher.

For the Type III conjugation system found in plasmids like pRleVF39b, a regulatory gene called trbR has been identified. Experimental evidence shows that TrbR functions as a repressor of both trb gene expression and plasmid transfer .

What is the relationship between trbI and other conjugation proteins in the mating pair formation system?

The trbI protein functions as part of a complex conjugation machinery, specifically within the mating pair formation (Mpf) system. This system creates the physical connection between donor and recipient cells necessary for DNA transfer. Understanding the interactions between trbI and other components is crucial for elucidating the mechanism of conjugal DNA transfer in rhizobia.

The Mpf components form a complex structure similar to a type IV secretion system that spans the bacterial cell envelope . The trbI gene is typically found within a cluster of other conjugation genes, including those encoding the complete set of Mpf proteins, a traG gene, and a relaxase gene (traA) . Mutagenesis studies have shown that these components are all necessary for plasmid transfer, indicating that trbI functions in concert with these other proteins to form a functional conjugation apparatus.

In the RctA-regulated system, trbI-related genes are found in the virB operon, which contains virB1 to virB11 genes that encode the core components of the conjugation channel . These genes are homologous to those found in Agrobacterium tumefaciens, suggesting conservation of the basic conjugation machinery across different bacterial species in the Rhizobiales order.

How does the function of trbI in Rhizobium compare to homologous proteins in other bacterial genera?

The function of trbI in Rhizobium can be compared to homologous proteins in other bacterial genera to understand evolutionary relationships and functional conservation in conjugation systems. This comparison provides insights into the origins and diversification of bacterial conjugation mechanisms.

Research indicates that rhizobial conjugation systems containing trbI share evolutionary relationships with conjugation systems in Agrobacterium tumefaciens and other alpha-proteobacteria . Functional homologues of conjugation genes, including those related to trbI, have been found on plasmids pAtC58 of A. tumefaciens and pSme1021a of Sinorhizobium meliloti, indicating that similar conjugation models apply to these organisms .

The intergeneric transmission of plasmids between Rhizobium and Agrobacterium has been demonstrated, showing that conjugation machinery from one genus can function in the other . This suggests functional conservation of key components like trbI across these related bacterial genera. Phylogenetic analysis based on 16s rRNA has shown that Agrobacterium and Rhizobium are closely related, and the amalgamation of these two genera has often been suggested .

While core components of conjugation systems are often conserved, regulatory elements can evolve more rapidly, leading to diverse control mechanisms for fundamentally similar transfer machinery. For example, the RctA-repressed system found in some rhizobia represents a different regulatory strategy compared to the quorum sensing systems commonly found in other bacterial genera.

What methodological approaches can resolve contradictions in experimental data regarding trbI function?

Researchers studying trbI function may encounter contradictory experimental results due to various factors including strain-specific differences, experimental conditions, or technical limitations. To resolve such contradictions, several methodological approaches can be employed:

  • Standardized experimental systems: Establishing consistent experimental platforms for studying trbI function across different laboratories is essential. This includes defining standard strains and growth conditions, developing quantitative assays with appropriate controls, and implementing reporting standards for experimental parameters.

  • Multi-method validation: Confirming results using complementary methodologies can help distinguish real biological phenomena from technical artifacts. This involves combining genetic approaches (mutagenesis) with biochemical methods, using both in vivo and in vitro assays, and applying both targeted and global approaches (e.g., specific gene studies versus transcriptomics).

  • Systematic variance analysis: When contradictory results emerge, systematic investigation of potential sources of variation is crucial. This includes testing the effects of media composition, growth phase, and environmental conditions; examining strain-specific differences through comparative genomics; and assessing the influence of uncharacterized genetic elements (e.g., cryptic plasmids).

  • Origins of transfer (oriT) identification: Research has shown that multiple origins of transfer can exist within a single conjugation system . Experimental evidence has suggested the presence of two putative origins of transfer within gene clusters on some plasmids . Identifying and characterizing these elements can help explain variations in transfer efficiency or contradictory results from different experimental approaches.

  • Combined field and laboratory studies: Some contradictions may arise from differences between laboratory conditions and natural environments. Combining controlled laboratory experiments with field studies can provide a more complete understanding of trbI function under different conditions .

How can researchers design experiments to investigate the role of trbI in plant-rhizobia interactions?

Investigating the role of trbI in plant-rhizobia interactions requires experimental designs that bridge molecular microbiology with plant biology. Several methodological approaches can be employed:

  • Generation of trbI mutant strains:

    • Creation of clean deletion mutants using allelic exchange

    • Construction of conditional mutants using inducible promoters

    • Development of point mutations in specific domains

    • Design of trbI variants tagged with fluorescent proteins for localization studies

  • Nodulation and symbiosis assays:

    • Comparison of nodulation efficiency between wild-type and trbI mutant rhizobia

    • Assessment of nitrogen fixation activity using acetylene reduction assay

    • Microscopic analysis of infection thread formation and nodule development

    • Measurement of plant growth parameters under symbiotic conditions

  • Competitive nodulation experiments:

    • Co-inoculation of plants with differentially marked wild-type and mutant strains

    • Determination of competitive indices for nodule occupancy

    • Analysis of mixed populations in the rhizosphere over time

    • Evaluation of plasmid transfer during symbiotic interaction

  • Field-based expression analysis:

    • Development of reporter gene fusions (trbI promoter with gfp or similar) for in situ monitoring

    • Design of specific primers and probes for quantitative RT-PCR analysis of trbI expression in soil samples

    • RNA-seq analysis of rhizobial transcriptomes isolated directly from soil or rhizosphere

    • Proteomics approaches to detect and quantify TrbI protein in environmental samples

The experimental design should consider that while trbI primarily functions in conjugative transfer, it may indirectly affect symbiosis through the transfer of symbiotic plasmids or other genetic elements . Time-course experiments would be valuable to distinguish between immediate effects of trbI mutation and long-term consequences for symbiotic interactions and rhizobial population dynamics in the rhizosphere.

How can trbI and related conjugation systems be harnessed for biotechnological applications?

The trbI protein and rhizobial conjugation systems have significant potential for biotechnological applications, particularly in the fields of plant genetic engineering and sustainable agriculture:

  • Development of novel DNA delivery vectors: The conjugation machinery containing trbI could be engineered to create efficient DNA delivery systems for introducing beneficial genes into agricultural microbiomes . This would require identification of minimal components necessary for functional conjugation, engineering of compact, modular conjugation systems, and development of broad-host-range vectors compatible with diverse bacterial recipients.

  • Creation of Rhizobium-mediated plant transformation systems: Research indicates that Rhizobia can be used as alternatives to Agrobacterium for plant genetic engineering . Rhizobium sp. serves as an open license source with no major restrictions in plant biotechnology and helps broaden the spectrum for plant biotechnologists with respect to the use of gene transfer vehicles in plants . Optimizing trbI-containing conjugation systems could enhance the efficiency of DNA transfer to plant cells.

  • Field-level manipulation of microbial communities: Engineered conjugation systems could be used to spread beneficial traits (such as improved nitrogen fixation or phosphate solubilization) among indigenous rhizobial populations in agricultural soils. Studies have shown that transconjugants may gain not only symbiotic capabilities but also improved saprophytic competence, such as prototrophy for certain vitamins, which could lead to better survival in the soil .

  • Agricultural applications: Understanding conjugation systems in rhizobia provides foundations for maintaining, monitoring, and predicting the behavior of large rhizobial plasmids during field release events . This knowledge is crucial for developing improved rhizobial inoculants that can increase leguminous crop yields while ensuring biosafety through controlled gene transfer.

What optimal conditions enable the expression and purification of recombinant trbI protein for structural studies?

Expressing and purifying recombinant trbI protein presents challenges due to its likely membrane-associated nature. Based on available information and best practices for similar proteins, the following methodological approaches are recommended:

  • Expression system selection:

    • Bacterial systems: E. coli BL21(DE3) or its derivatives are commonly used, but expression may be optimized using strains designed for membrane proteins like C41(DE3) or C43(DE3)

    • Cell-free expression systems: These avoid toxicity issues and may be suitable for membrane proteins

    • Homologous expression: Using Rhizobium species as expression hosts may provide appropriate cellular machinery for correct folding

  • Construct design and optimization:

    • Codon optimization for the selected expression host

    • Addition of fusion tags (His6, MBP, GST) to facilitate purification

    • Construction of truncated versions focusing on soluble domains

    • Inclusion of TEV or other protease cleavage sites for tag removal

  • Expression condition optimization:

    • Temperature variation (typically lower temperatures of 16-25°C improve folding)

    • Induction strategy (IPTG concentration, auto-induction media)

    • Growth media composition (enriched media like TB or minimal media)

    • Addition of specific additives (glycerol, specific ions, or chaperone co-expression)

  • Solubilization and purification strategies:

    • For membrane-associated regions: testing various detergents (DDM, LDAO, Triton X-100)

    • For soluble domains: standard purification using affinity chromatography

    • Implementing size exclusion chromatography as a final purification step

    • Considering the use of amphipols or nanodiscs for stabilizing membrane proteins

Based on the amino acid sequence provided in the search results, trbI appears to have hydrophobic regions that may correspond to transmembrane domains . Therefore, expression strategies that account for its potential membrane association would be most appropriate. The recombinant protein should be stored in buffer conditions that maintain stability, potentially including 50% glycerol as mentioned in the product description .

What emerging technologies could advance our understanding of trbI function in conjugative transfer?

Several emerging technologies hold promise for advancing our understanding of trbI function in conjugative transfer. These methodological approaches could overcome current limitations and provide new insights:

  • Advanced imaging technologies:

    • Super-resolution microscopy (STORM, PALM) to visualize conjugation machinery at nanometer scale

    • Cryo-electron tomography to capture 3D structures of intact conjugation complexes

    • Correlative light and electron microscopy to link functional and structural data

    • 4D live-cell imaging to track dynamic assembly of conjugation apparatus

  • Single-cell and single-molecule techniques:

    • Single-cell RNA-seq to capture transcriptional heterogeneity during conjugation

    • Single-molecule tracking to follow individual trbI proteins during complex assembly

    • FRET-based biosensors to detect conformational changes during function

    • Optical tweezers or magnetic tweezers to measure forces during conjugal DNA transfer

  • Genome editing and synthetic biology:

    • CRISPR-Cas systems for precise genome editing in rhizobia

    • Optogenetic control of trbI expression or activity

    • Minimal synthetic conjugation systems to determine essential components

    • Cell-free reconstitution of conjugation machinery for controlled studies

  • Systems biology approaches:

    • Multi-omics integration (genomics, transcriptomics, proteomics, metabolomics)

    • Flux balance analysis to understand metabolic requirements for conjugation

    • Agent-based modeling of conjugation dynamics in bacterial populations

    • Network analysis to identify global cellular responses to conjugation

How do environmental factors influence the expression and function of trbI in natural soil environments?

Understanding how environmental factors affect trbI expression and function in natural soil environments is crucial for predicting conjugative transfer events in agricultural settings. This research area combines molecular biology with ecology and requires specialized methodological approaches:

  • Environmental parameter correlation:

    • Systematic measurement of soil properties (pH, temperature, moisture, nutrient levels) alongside trbI expression

    • Multivariate statistical analyses to identify environmental factors with significant impacts

    • Construction of predictive models for conjugation frequency based on environmental parameters

    • Validation of models through controlled soil microcosm experiments

  • Experimental ecology approaches:

    • Design of soil microcosms with controlled environmental gradients

    • Introduction of marked donor and recipient strains to track conjugation events

    • Use of flow cytometry sorting combined with molecular detection to isolate transconjugants

    • Application of stable isotope probing to link metabolic activity with conjugation frequency

  • Host plant influence assessment:

    • Investigation of how plant species and developmental stage affect conjugation rates

    • Analysis of root exudate effects on trbI expression and conjugation efficiency

    • Examination of rhizosphere versus bulk soil differences in conjugation frequency

    • Study of seasonal variations in relation to plant growth cycles

Research has indicated that conjugative transfer in rhizobia can be influenced by several environmental factors . The expression of trbI and other conjugation genes may respond to rhizosphere signals, plant exudates, or changes in nutrient availability. Additionally, the physical structure of soil can affect bacterial cell density and contact rates, which in turn influence conjugation frequency.

An important consideration is that environmental conditions triggering conjugation may not be the same as those favoring the establishment and growth of transconjugants. For instance, while transconjugants might be isolated by their ability to nodulate specific plants, their population growth could be favored by improved saprophytic competence, such as prototrophy for certain vitamins . Understanding these complex interactions requires integrated approaches that combine laboratory experiments with field studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.