Recombinant Rhizobium sp. Probable peptide ABC transporter permease protein y4tP (NGR_a01430)

Shipped with Ice Packs
In Stock

Description

Core Characteristics

The recombinant protein is produced in E. coli as a full-length (1–313 amino acids) construct with an N-terminal His-tag for purification and detection . Key specifications include:

ParameterValue
SpeciesSinorhizobium fredii (strain NGR234)
Host SystemE. coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 50% glycerol recommended

The protein’s amino acid sequence (MGVYILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEP...) reveals a hydrophobic profile typical of transmembrane domains .

Role in Symbiotic Processes

NGR_a01430 is encoded on the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234, which is critical for nitrogen-fixing symbiosis with legumes . Key functional clues include:

  • Regulatory Context: A nod box upstream of the gene suggests transcriptional control by nodD1, a master regulator of symbiotic gene expression .

  • ABC Transporter Classification: Structurally, it belongs to the ATP-binding cassette (ABC) transporter superfamily, which typically facilitates substrate translocation using ATP hydrolysis .

While the exact substrate remains uncharacterized, ABC transporters in symbiotic contexts often mediate the uptake or export of signaling molecules (e.g., nod factors, rhizopines) .

Experimental Uses

This recombinant protein serves as a tool for studying ABC transporter mechanisms and symbiotic interactions:

ApplicationDetails
ELISA AssaysUsed as an antigen in ELISA kits for detecting anti-NGR_a01430 antibodies
Structural StudiesComputational models (e.g., AlphaFold) predict transmembrane domains and ATP-binding regions
Functional AssaysPotential substrate-binding studies or ATPase activity assays

Plasmid Organization

NGR_a01430 is part of a cluster of genes on pNGR234a, including:

  • Replication/Conjugal Transfer: ORFs encoding RepABC proteins (homologs of Agrobacterium tumefaciens Ti-plasmid components) .

  • Symbiotic Functions: ORFs linked to nodulation (e.g., nod boxes, type III secretion systems) .

ABC Transporter Architecture

Though no experimental structure exists for y4tP, computational models of related ABC transporters (e.g., Pyrococcus horikoshii PH1216) reveal:

  • Transmembrane Domains: Hydrophobic α-helices forming a gated pore .

  • ATP-Binding Domains: Conserved motifs (Walker A/B) for ATP hydrolysis .

Critical Research Gaps

Despite its availability, key questions remain:

  1. Substrate Specificity: No experimental data identifies the transported molecule.

  2. Symbiotic Role: Direct evidence linking y4tP to nod factor transport or rhizopine metabolism is lacking .

  3. Structural Dynamics: Experimental validation of computational models is needed .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a01430; y4tP; Probable peptide ABC transporter permease protein y4tP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a01430
Target Protein Sequence
MGVYILRRLVSTIAVMAMVGIFIFLLLRLAPGDPAAVIAGPTATEQMVANIREELGLNEP LPVQFVHWASDVLRGNFGASVFTGVPVLQLLSQRLEPTISLSVLTMILSVTVGVSFGVLA AWRSGGFVDRALATFSAIGYSVPVFVIGYILIYFFAIQTRWLPVQGYTSINQGVAPWFLH LILPTVTLSVPYIAFIARITRGSMLEVLSEDYMRTAAAKGASPFAMLFHHALKNAGVPIL TVIGISFAYMIGGVVLTETVFNVPGIGRLVVDAIKNRDYPIIQTVLVLISGLYVLINLLV DLAYTLIDPRIRY
Uniprot No.

Target Background

Function
This protein is likely a component of the binding-protein-dependent transport system y4tOPQRS for a peptide. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the y4tP gene in Rhizobium sp. strain NGR234?

The y4tP gene (NGR_a01430) is located on the 0.54-Mbp symbiotic plasmid (pNGR234a) of Rhizobium sp. strain NGR234 . Unlike essential cellular growth functions that are primarily encoded on the 3.93-Mbp chromosome (cNGR234), the symbiotic plasmid contains genes specifically involved in the nitrogen-fixing symbiotic relationship with legume hosts . The genomic organization around y4tP likely includes other genes related to peptide transport, as ABC transporters typically function as complexes requiring multiple components. The precise positioning and flanking sequences may provide insights into the evolutionary history and functional relationships of this transporter gene within the broader context of symbiotic processes.

How does the structure of y4tP compare to other characterized ABC transporter permease proteins?

While specific structural data for y4tP is limited, ABC transporter permease proteins generally contain multiple transmembrane domains that form a channel through which substrates are transported . Based on studies of related ABC transporters, y4tP likely functions through conformational switches between inward-facing and outward-facing states to facilitate substrate translocation across the membrane . The protein would be expected to possess conserved motifs characteristic of ABC transporter permease components, though specific binding sites may be uniquely adapted to its particular substrate specificity. Structural comparisons with other characterized ABC transporters would require techniques such as X-ray crystallography or cryo-electron microscopy to determine the three-dimensional configuration of y4tP.

What is the predicted substrate specificity of the y4tP transporter?

As a probable peptide ABC transporter permease protein, y4tP is likely involved in the transport of peptides across the bacterial membrane. The substrate specificity would be determined by the binding pocket configuration and amino acid residues that interact with the substrate . Computational prediction methods based on sequence homology with other characterized ABC transporters can provide initial insights into potential substrates. Experimental verification through substrate binding assays or transport studies with labeled peptides would be necessary to confirm these predictions. The specific peptides transported by y4tP may play roles in signaling during symbiotic interactions, nutrient acquisition, or other processes essential for the bacterium's survival and symbiotic function.

How might post-translational modifications affect the function of recombinant y4tP in experimental systems?

Post-translational modifications (PTMs) can significantly impact protein function, and this consideration is crucial when working with recombinant y4tP. In bacterial systems, PTMs such as phosphorylation, methylation, or acetylation may regulate the activity, localization, or interactions of ABC transporters. When expressing recombinant y4tP, researchers should evaluate whether the expression system (e.g., E. coli, yeast, or insect cells) can replicate the PTMs that occur in the native Rhizobium sp. environment.

Experimental approaches to address this question include:

  • Comparative mass spectrometry analysis of native versus recombinant y4tP to identify missing or aberrant modifications

  • Site-directed mutagenesis of potential modification sites to assess functional consequences

  • Co-expression with relevant modification enzymes to ensure proper processing

Discrepancies in experimental results when using recombinant y4tP may be attributed to differences in PTM patterns, necessitating careful interpretation and validation in native systems when possible.

What are the kinetic parameters of substrate transport by the y4tP-containing ABC transporter complex and how do they compare across different symbiotic states?

The kinetic properties of the y4tP-containing ABC transporter complex likely vary depending on the symbiotic state of the bacterium. To characterize these parameters, researchers would need to:

  • Reconstitute the complete transporter complex in proteoliposomes or membrane vesicles

  • Measure transport rates using radiolabeled or fluorescently tagged substrates

  • Determine Km, Vmax, and transport efficiency under various conditions

A comparative analysis might reveal that different symbiotic states (free-living versus nodule-associated) result in altered kinetic parameters. This could be presented in a data table format:

Symbiotic StateKm (μM)Vmax (nmol/min/mg)Transport Efficiency (Vmax/Km)
Free-livingX ± SDX ± SDX ± SD
Early nodulationX ± SDX ± SDX ± SD
Mature noduleX ± SDX ± SDX ± SD

Such data would provide insights into how transport activity is regulated during different stages of the symbiotic relationship, potentially correlating with changing metabolic needs or signaling requirements.

How does the interaction between y4tP and other components of the ABC transporter complex influence substrate specificity and transport efficiency?

ABC transporters function as multicomponent complexes, with permease proteins like y4tP working in concert with substrate-binding proteins and ATP-binding cassette proteins . The specific interactions between these components can dramatically influence both substrate specificity and transport efficiency.

Research approaches to investigate these interactions include:

  • Co-immunoprecipitation studies to identify protein-protein interactions

  • Förster resonance energy transfer (FRET) to measure dynamic interactions in living cells

  • Bacterial two-hybrid screens to map interaction domains

  • Site-directed mutagenesis to identify critical residues for complex assembly and function

Interactions between y4tP and substrate-binding proteins would be particularly important for determining which peptides are recognized and transported. Additionally, the coupling between y4tP and the ATP-binding components influences how efficiently energy from ATP hydrolysis is converted to mechanical work for substrate translocation across the membrane.

What are the optimal conditions for expressing recombinant y4tP while maintaining proper folding and functionality?

Membrane proteins like y4tP are notoriously challenging to express in recombinant systems due to their hydrophobic nature and complex folding requirements. Based on experiences with similar ABC transporter components, the following protocol represents an optimized approach:

  • Expression system selection:

    • E. coli C41(DE3) or C43(DE3) strains specifically developed for membrane protein expression

    • Alternative systems include Pichia pastoris for eukaryotic processing capabilities

  • Expression conditions:

    • Induction at lower temperatures (16-20°C) to slow protein synthesis and allow proper folding

    • Extended expression periods (16-24 hours) at reduced inducer concentrations

    • Supplementation with specific lipids that facilitate membrane protein folding

  • Solubilization and purification:

    • Gentle detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG)

    • Purification in the presence of lipids or cholesterol hemisuccinate

    • Size exclusion chromatography as a final purification step to ensure homogeneity

  • Functional validation:

    • Reconstitution into proteoliposomes

    • Substrate binding assays

    • ATPase activity measurements in the reconstituted complex

Success with recombinant y4tP expression would be indicated by yields of 1-3 mg of purified protein per liter of culture, with >90% purity as assessed by SDS-PAGE and >80% properly folded protein as determined by circular dichroism spectroscopy.

How can researchers effectively design mutagenesis studies to identify critical residues in y4tP for substrate recognition and transport?

A systematic mutagenesis approach is essential for identifying functional domains and critical residues in y4tP. The following strategy combines computational prediction with experimental validation:

  • Initial target selection:

    • Sequence alignment with characterized ABC transporter permeases to identify conserved motifs

    • Homology modeling to predict membrane topology and potential substrate-interacting regions

    • Computational docking of predicted peptide substrates to identify potential binding residues

  • Mutagenesis strategy:

    • Alanine-scanning mutagenesis of predicted transmembrane segments

    • Conservative and non-conservative substitutions at predicted substrate-interacting sites

    • Introduction of reporter residues (e.g., cysteine) for accessibility studies

  • Functional assays:

    • Transport assays using radiolabeled substrates in reconstituted systems

    • Substrate binding assays using modified peptides

    • Crosslinking studies to trap substrate-permease intermediates

  • Structural validation:

    • Distance measurements using double electron-electron resonance (DEER) spectroscopy

    • Site-specific fluorescence labeling to monitor conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify protected regions

This combination of approaches can generate a functional map of y4tP, identifying residues critical for substrate specificity, translocation pathway formation, and coupling to ATP hydrolysis.

What techniques are most effective for studying the in vivo dynamics of y4tP during different stages of symbiotic nodule development?

Understanding the dynamics of y4tP during symbiotic nodule development requires techniques that can track protein localization, expression, and function in the context of the host-microbe interaction. The following methodological approaches are particularly suited to this challenge:

  • Spatiotemporal expression analysis:

    • Construction of y4tP-reporter fusions (GFP, mCherry) under native promoter control

    • Confocal microscopy of nodule sections at different developmental stages

    • Fluorescence correlation spectroscopy to measure protein mobility in bacterial membranes

  • Protein abundance quantification:

    • Targeted proteomics using selected reaction monitoring (SRM) mass spectrometry

    • Western blotting with specific antibodies against y4tP

    • Ribosome profiling to measure translation efficiency of y4tP mRNA

  • Functional studies in planta:

    • Construction of inducible/repressible y4tP variants to manipulate expression during specific nodule development stages

    • Metabolomic analysis of peptide pools in nodules with normal versus altered y4tP function

    • Correlation of transporter activity with nitrogen fixation efficiency

These approaches can reveal how y4tP function is integrated into the broader symbiotic program and how its activity might be regulated in response to changing conditions during nodule development and maturation.

How should researchers interpret conflicting results between in vitro reconstitution studies and in vivo analyses of y4tP function?

Discrepancies between in vitro and in vivo studies of y4tP function are common and can provide valuable insights when properly interpreted. When faced with such conflicts, researchers should consider:

  • System complexity differences:

    • In vitro systems lack the full complement of interacting proteins present in vivo

    • The lipid environment in reconstituted systems may not perfectly mimic native membranes

    • Post-translational modifications may differ between systems

  • Analytical approach:

    • Compare substrate concentration ranges between studies (physiological versus experimental)

    • Assess whether ATP/energy availability differs between systems

    • Consider whether regulatory factors present in vivo are absent in vitro

  • Resolution strategies:

    • Design hybrid approaches (e.g., membrane vesicles from native bacteria)

    • Validate key findings using multiple complementary techniques

    • Incrementally increase system complexity to identify the source of discrepancies

A methodical comparison of results can transform apparent contradictions into valuable insights about the cellular context required for proper y4tP function, potentially revealing unknown regulatory mechanisms or interacting partners.

What bioinformatic approaches are most useful for predicting substrate specificity of y4tP compared to other ABC transporter permease proteins?

Predicting substrate specificity of ABC transporter permeases like y4tP requires sophisticated bioinformatic approaches that integrate sequence, structural, and evolutionary information:

  • Sequence-based methods:

    • Hidden Markov Models (HMMs) built from functionally characterized transporters

    • Analysis of conserved motifs in substrate-binding regions

    • Identification of specificity-determining positions through statistical coupling analysis

  • Structure-based predictions:

    • Homology modeling based on crystallized ABC transporters

    • Molecular dynamics simulations to identify stable substrate binding poses

    • Analysis of electrostatic and hydrophobic properties of the predicted translocation pathway

  • Comparative approaches:

    • Phylogenetic profiling to correlate transporter presence with metabolic capabilities

    • Analysis of gene neighborhoods for co-occurrence with substrate processing enzymes

    • Comparison of selection pressure patterns across different bacterial lineages

  • Machine learning integration:

    • Training neural networks on known transporter-substrate pairs

    • Feature extraction from multiple sequence alignments

    • Validation through cross-referencing with experimental transport assays

These computational predictions should be validated experimentally, but they can substantially narrow the range of potential substrates and guide the design of focused binding and transport assays.

How can researchers differentiate between direct effects of y4tP mutation and indirect effects due to disrupted symbiotic signaling?

Distinguishing direct from indirect effects of y4tP mutations presents a significant challenge in symbiotic systems where multiple signaling networks operate simultaneously. A comprehensive approach includes:

  • Genetic complementation strategies:

    • Expression of wild-type y4tP under inducible promoters at different symbiotic stages

    • Creation of chimeric transporters with functional domains from related systems

    • Suppressor screens to identify compensatory mutations

  • Temporal analysis:

    • Detailed time-course studies to establish the sequence of phenotypic changes

    • Correlation of molecular events with anatomical developments

    • Identification of the earliest detectable differences between wild-type and mutant systems

  • Targeted metabolomics:

    • Quantification of potential substrate accumulation/depletion in specific cellular compartments

    • Isotope labeling to track metabolite flux through affected pathways

    • Comparison with mutants affecting known signaling pathways

  • Direct transport measurements:

    • Development of transport assays using isolated bacteroids

    • Application of fluorescent substrate analogs for in situ visualization

    • Electrophysiological recordings of transport activity where feasible

By integrating these approaches, researchers can build a causal model that distinguishes primary effects directly attributed to altered y4tP function from secondary consequences that ripple through the symbiotic system.

What novel approaches could be developed to study the real-time dynamics of substrate transport by y4tP in living bacteria?

Advancing our understanding of y4tP function requires innovative techniques for real-time monitoring of transport activity. Promising approaches include:

  • Genetically encoded biosensors:

    • Development of FRET-based sensors that respond to substrate binding or transport

    • Creation of conformational reporters integrated into non-essential regions of y4tP

    • Coupling of substrate detection to transcriptional activation of reporter genes

  • Advanced microscopy techniques:

    • Single-molecule tracking of fluorescently labeled substrates

    • Super-resolution microscopy to visualize transporter clustering and dynamics

    • Light-sheet microscopy for rapid 3D imaging of bacterial cells during transport events

  • Microfluidic approaches:

    • Development of bacterial traps that allow precise control of substrate delivery

    • Integration with electrical or optical detection systems

    • Creation of artificial nodule-like microenvironments

  • Spectroscopic methods:

    • Application of vibrational spectroscopy to detect bond changes during transport

    • Development of site-specific labels for electron paramagnetic resonance studies

    • Use of nanobodies conjugated to environmentally sensitive dyes

These technical innovations would provide unprecedented insights into the kinetics and mechanics of peptide transport by y4tP, potentially revealing regulatory mechanisms and transport intermediates not accessible through traditional approaches.

How might CRISPR-Cas technologies be optimized for precise manipulation of y4tP in Rhizobium sp. strain NGR234?

The application of CRISPR-Cas technologies to Rhizobium species requires specific optimizations to overcome challenges related to delivery, efficiency, and specificity:

  • Delivery optimization:

    • Development of specialized conjugation protocols for efficient plasmid transfer

    • Creation of Rhizobium-specific vectors with appropriate origin of replication

    • Optimization of electroporation parameters for ribonucleoprotein complex delivery

  • CRISPR system adaptations:

    • Codon optimization of Cas proteins for Rhizobium expression

    • Testing of alternative Cas variants (Cas12a, Cas9 from different species)

    • Development of inducible or tissue-specific Cas expression systems

  • Precision editing strategies:

    • Design of homology-directed repair templates optimized for Rhizobium recombination

    • Application of base editors for single nucleotide modifications without double-strand breaks

    • Development of scarless editing approaches to minimize disruption of operon structure

  • Validation approaches:

    • Deep sequencing to detect off-target effects

    • Phenotypic screening across multiple symbiotic hosts

    • Complementation testing to confirm specificity of observed effects

These optimizations would enable precise engineering of y4tP variants with altered substrate specificity, transport kinetics, or regulatory properties, facilitating detailed structure-function analyses and potentially enhancing symbiotic capabilities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.