Recombinant Rhizobium sp. Probable peptide ABC transporter permease protein y4tQ (NGR_a01420)

Shipped with Ice Packs
In Stock

Description

Protein Overview and Identification

The Probable peptide ABC transporter permease protein y4tQ is encoded by the NGR_a01420 gene located on the genome of Rhizobium sp. strain NGR234. This protein has been assigned the UniProt identification number Q53192 and is classified as a transmembrane protein component of an ABC transport system . The full-length protein consists of 291 amino acid residues and functions as a permease, forming the transmembrane channel through which substrate molecules are transported across the bacterial cell membrane.

Genomic Organization in Rhizobium sp. NGR234

The y4tQ gene (NGR_a01420) is part of the extensive genome of Rhizobium sp. strain NGR234, which is notable for its remarkable capacity to form nitrogen-fixing nodules with a wider range of legumes than any other known microsymbiont . The complete genome of this strain spans approximately 6.9 Mbp and consists of a chromosome (cNGR234, 3.93 Mbp) and two plasmids: the megaplasmid pNGR234b (2.43 Mbp) and the symbiotic plasmid pNGR234a (0.54 Mbp) . The y4tQ gene is specifically located on one of these genetic elements and likely forms part of an operon encoding multiple components of the ABC transporter complex.

Relationship to Secretory Systems

Rhizobium sp. strain NGR234 possesses an extraordinary array of secretion systems, with a total of 132 genes and proteins linked to secretory processes . The genome encodes more different secretion systems than any other known rhizobia and possibly most known bacteria. These include general and export pathways, a twin arginine translocase secretion system, six type I transporter genes, type III systems, and multiple type IV systems . While the y4tQ protein is specifically categorized as part of an ABC transporter system, it functions within this broader context of elaborate secretory machinery that facilitates the bacterium's complex interactions with host plants.

ABC Transporters in Bacterial Physiology

ABC transporters represent one of the largest protein superfamilies and are ubiquitous across all domains of life. In bacteria, these transport systems are composed of multiple components: typically ATP-binding proteins (providing energy through ATP hydrolysis), permease proteins (forming the transmembrane channel), and substrate-binding proteins (determining substrate specificity) . The y4tQ protein functions as a permease component, forming the channel through which specific peptides are transported across the bacterial membrane.

Role in Symbiotic Nitrogen Fixation

Rhizobium sp. strain NGR234 is distinguished by its extraordinary ability to form nitrogen-fixing nodules with more than 120 genera of legumes . This symbiotic relationship involves complex molecular exchanges between the bacterium and host plant, with the bacterium providing fixed nitrogen in exchange for carbon compounds from the plant. The peptide ABC transporter containing y4tQ likely plays a role in this symbiotic exchange, potentially facilitating the import of specific peptides or amino acids from the plant environment, or participating in the export of symbiosis-related signaling molecules .

Adaptation to Environmental Conditions

The genome of NGR234 carries genes and regulatory networks linked to the metabolism of a wide range of aromatic and nonaromatic compounds, enabling rapid adaptation to changing environmental stimuli in soils, rhizospheres, and plants . The y4tQ protein, as part of the peptide transport machinery, likely contributes to this adaptability by enabling the bacterium to utilize different peptide sources depending on environmental availability.

Expression Systems and Purification

The recombinant form of y4tQ protein has been successfully expressed in Escherichia coli expression systems, typically with an N-terminal His-tag to facilitate purification . The full-length protein (amino acids 1-291) can be produced in significant quantities for research and analytical purposes. Purification typically involves affinity chromatography utilizing the His-tag, followed by additional purification steps as needed to achieve high purity .

Table 1: Production Characteristics of Recombinant y4tQ Protein

ParameterSpecificationReference
Expression SystemE. coli
Protein LengthFull Length (1-291 aa)
TagN-terminal His-tag
UniProt IDQ53192
Purity>90% (by SDS-PAGE)
FormLyophilized powder

Current Research Utilization

The recombinant y4tQ protein serves as a valuable tool for investigating the molecular mechanisms of bacterial transport systems, particularly in the context of symbiotic nitrogen fixation. The availability of the purified protein enables structural studies, functional assays, and interaction analyses with other components of the ABC transporter complex . Additionally, the protein can be utilized in antibody production for immunological studies and the development of detection methods for Rhizobium species in environmental and agricultural samples.

Future Research Directions

Future research on the y4tQ protein is likely to focus on several key areas:

  1. Structural characterization through advanced techniques such as cryo-electron microscopy or X-ray crystallography to determine the precise three-dimensional arrangement of the protein.

  2. Functional assays to identify the specific peptide substrates transported by the ABC transporter complex containing y4tQ.

  3. Investigation of the role of y4tQ in the symbiotic relationship between Rhizobium sp. NGR234 and its numerous legume hosts.

  4. Exploration of potential biotechnological applications, such as engineering more efficient nitrogen-fixing bacteria for agricultural use.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a01420; y4tQ; Probable peptide ABC transporter permease protein y4tQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a01420
Target Protein Sequence
MALTTSRASGSPRIQTHTVVRIAKRHPLVLLGGGILLLLILLALAAPLYSGDPLVMDPFK RLQQPSASMWFGTDNLGRDVFARTIYGARISLIVGLLSAVCAAVCGLLIGVIAGYSRTFD NIIMRVMDGLMSIPTFLLAIALLSLTGPGIGILIVAIAIPETPAVTRLVRSVVLSVRSRP YVEAALCGGARLPRVLWRHILPSTIPPLMVQSATVCASAIMTEAGLSFIGVGVPSEIPSW GNMIANSRLFLAIAPLTIFAPGLCLAVTVLAVNLLGDGLRDMFDPRSKRRR
Uniprot No.

Target Background

Function
This protein is likely part of the binding-protein-dependent transport system y4tOPQRS for a peptide. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the y4tQ (NGR_a01420) gene in Rhizobium sp. strain NGR234?

The y4tQ (NGR_a01420) gene is located on the 0.54-Mbp symbiotic plasmid (pNGR234a) of Rhizobium sp. strain NGR234. This is significant because pNGR234a does not contain essential genes for cellular growth, but instead carries genes specifically involved in symbiotic interactions with host plants. The absence of essential genes on this symbiotic plasmid is consistent with observations that strains lacking pNGR234a grow normally but fail to nodulate host plants . The genomic organization of NGR234 consists of a 3.93-Mbp chromosome (cNGR234) encoding most functions required for cellular growth, a 2.43-Mbp megaplasmid (pNGR234b) with few essential functions, and the symbiotic plasmid pNGR234a where y4tQ is located .

How does the y4tQ protein fit into the broader ABC transporter family?

The y4tQ protein is classified as a probable peptide ABC transporter permease component. ABC transporters constitute one of the largest families of membrane proteins in most organisms . The permease component typically forms the transmembrane domain (TMD) that creates the substrate translocation pathway across the membrane.

ABC transporters generally consist of four core domains: two nucleotide-binding domains (NBDs) that bind and hydrolyze ATP, and two TMDs that form the substrate translocation pathway. In the case of y4tQ, it functions as one of the TMD components in a peptide transport system. ABC transporters in bacterial systems often have their components encoded by separate genes, with the permease components (like y4tQ) working in conjunction with nucleotide-binding proteins and substrate-binding proteins to form functional transport complexes .

What experimental methods are recommended for expressing recombinant y4tQ protein?

Based on established protocols for ABC transporter proteins, several expression systems can be utilized for recombinant production of y4tQ:

Table 1: Comparison of Expression Systems for Recombinant y4tQ Production

Expression SystemAdvantagesChallengesOptimization Strategies
E. coli- Fast growth
- High yield
- Low cost
- Protein misfolding
- Inclusion body formation
- Lack of post-translational modifications
- Use of specialized strains (C41, C43)
- Lowering induction temperature (16-20°C)
- Fusion tags (MBP, SUMO)
Yeast (P. pastoris)- Eukaryotic folding machinery
- Post-translational modifications
- High-density cultivation
- Longer expression time
- Glycosylation patterns differ from native
- Codon optimization
- Methanol induction optimization
- Signal sequence selection
Insect cells- Proper folding of complex proteins
- Post-translational modifications
- Higher cost
- Longer expression time
- Technical complexity
- Baculovirus optimization
- Cell line selection
- Infection timing

Methodologically, a systematic approach is recommended, beginning with testing small-scale expressions in E. coli using different strains, fusion tags, and expression conditions. For membrane proteins like y4tQ, detergent screening is crucial for solubilization and purification. Adapting protocols described for related ABC transporters, like those outlined by Pollock for CFTR expression , can be particularly valuable. Testing orthologues from different Rhizobium species may also yield proteins with improved stability and expression characteristics .

What structural characterization methods are most effective for studying the y4tQ protein?

Structural characterization of ABC transporter permease proteins like y4tQ requires an integrated approach combining multiple techniques:

  • X-ray Crystallography: While challenging for membrane proteins, this remains the gold standard for high-resolution structural determination. Success depends critically on protein stability and crystal packing. For y4tQ, strategies similar to those used for McjD (an antibacterial peptide transporter) would be appropriate . This includes extensive detergent screening, lipid supplementation, and potentially the use of antibody fragments to stabilize specific conformations.

  • Cryo-Electron Microscopy (Cryo-EM): This technique has revolutionized membrane protein structural biology. Single-particle analysis can provide high-resolution insights without the need for crystallization . For y4tQ, achieving a sample with high purity, homogeneity, and appropriate particle size distribution is crucial for successful cryo-EM analysis.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Combined with site-directed spin labeling, EPR can measure distances between specific residues and probe accessibility in different conformational states. As demonstrated with P-glycoprotein, this approach provides valuable information on conformational dynamics . For y4tQ, strategic placement of spin labels at key positions could reveal conformational changes during the transport cycle.

  • Molecular Dynamics (MD) Simulations: Using homology models based on related ABC transporters, MD simulations can provide insights into conformational dynamics and substrate interactions. This approach has been successfully applied to P-glycoprotein and could be adapted for y4tQ to investigate its conformational flexibility and potential substrate binding sites .

  • X-ray Radiolytic Footprinting combined with Mass Spectrometry (XF-MS): This emerging technique can identify structural waters and conformational changes in proteins, and is applicable to protein complexes . For y4tQ, XF-MS could provide unique insights into its interaction with other components of the ABC transporter complex.

An integrated approach combining these methods is recommended, as each technique provides complementary information. Homology modeling using structures of related ABC transporters can guide experimental design and interpretation.

How can researchers investigate the substrate specificity of y4tQ?

Investigating substrate specificity of ABC transporter permease proteins like y4tQ requires a multi-faceted approach:

  • Transport Assays in Reconstituted Systems: Purified y4tQ protein, along with its associated ABC transporter components, can be reconstituted into liposomes or nanodiscs. Transport activity can then be measured using radiolabeled or fluorescently labeled potential substrates. This approach allows for controlled testing of specific substrates under defined conditions.

  • Functional Complementation: Expressing y4tQ in heterologous systems lacking equivalent transporters can reveal substrate specificity through phenotypic rescue. Similar approaches have been successful with plant ABC transporters like ABCB14, which was shown to mediate malate uptake when expressed in E. coli and HeLa cells .

  • Binding Studies: Techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) can be used to measure direct binding of potential substrates to the purified protein.

  • Structure-Guided Mutagenesis: Based on structural models or homology with related transporters, key residues predicted to be involved in substrate binding can be mutated, and the effects on transport activity measured.

The y4tQ protein, being encoded on the symbiotic plasmid pNGR234a, likely plays a role in the Rhizobium-legume symbiotic interaction. To investigate this role, researchers can employ the following methodologies:

  • Gene Knockout/Complementation Studies: Creating a targeted deletion of the y4tQ gene, followed by phenotypic characterization of the mutant during symbiosis. Complementation with the wild-type gene or mutant variants can confirm phenotype specificity. Key phenotypes to assess include:

    • Nodulation efficiency and timing

    • Nitrogen fixation rates

    • Bacteroid development and persistence

    • Host range specificity

  • Expression Analysis: Monitoring y4tQ expression during different stages of symbiosis using:

    • Quantitative RT-PCR

    • Promoter-reporter fusions (GFP, LacZ)

    • RNA-Seq analysis of the symbiotic transcriptome

  • Protein Localization: Determining the subcellular localization of y4tQ during symbiosis using:

    • Immunogold electron microscopy

    • Fluorescent protein fusions

    • Cell fractionation and Western blotting

  • Metabolomic Analysis: Comparing metabolite profiles between wild-type and y4tQ mutant strains during symbiosis to identify potential transported substrates or metabolic pathways affected by y4tQ function.

  • Host Response Analysis: Investigating how the absence of y4tQ affects host plant responses, including:

    • Transcriptomic analysis of plant nodule tissue

    • Hormonal balance in nodules

    • Defense response activation

Table 3: Expected Phenotypic Outcomes for y4tQ Mutants Based on Potential Functions

Potential FunctionExpected Phenotype in y4tQ MutantExperimental ApproachKey Measurements
Import of plant signaling moleculesDelayed/reduced nodulationPlant-bacteria co-culture assaysNodule number, timing, development stages
Export of symbiotic signalsAltered infection thread formationMicroscopy of early infection eventsInfection thread morphology, progression
Nutrient acquisition during symbiosisReduced nitrogen fixationAcetylene reduction assayNitrogenase activity
Detoxification of host defense compoundsIncreased sensitivity to plant defense moleculesExposure to phytoalexinsGrowth inhibition, survival rates

The host range of NGR234 is exceptionally broad, encompassing more than 120 genera of legumes . This makes it an excellent model for studying the role of specific transporters like y4tQ in determining host specificity. Comparative studies across different host plants could reveal host-specific functions of y4tQ.

How can researchers address challenges in heterologous expression and purification of recombinant y4tQ protein?

Membrane proteins like y4tQ present significant challenges for heterologous expression and purification. Based on experiences with other ABC transporters, the following methodological approaches can address these challenges:

  • Construct Optimization:

    • Truncation analysis to identify minimal functional domains

    • Removal of flexible regions that may impede crystallization

    • Addition of thermostable fusion partners (T4 lysozyme, BRIL)

    • Testing orthologues from different species as recommended in structural studies of CFTR

  • Expression Optimization:

    • Controlled expression using tunable promoters

    • Co-expression with chaperones to improve folding

    • Expression as part of a larger functional complex to stabilize the protein

    • Screening multiple host systems beyond the standard E. coli (yeast, insect cells)

  • Solubilization and Purification:

    • Systematic detergent screening (starting with mild detergents like DDM, LMNG)

    • Nanodiscs or SMALPs (styrene maleic acid lipid particles) for detergent-free extraction

    • Lipid supplementation during purification to maintain native-like environment

    • GFP fusion for monitoring extraction efficiency and protein stability

  • Stability Assessment:

    • Thermal shift assays to identify stabilizing conditions

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to assess homogeneity

    • Limited proteolysis to identify stable domains

    • Engineering disulfide bonds to stabilize specific conformations

Table 4: Troubleshooting Guide for Common Expression and Purification Challenges

ChallengePossible CausesSolutionsSuccess Indicators
Low expression levelsToxicity, poor translation, protein degradation- Reduce expression temperature
- Use C41/C43 E. coli strains
- Codon optimization
- Add protease inhibitors
- Western blot showing increased protein
- Improved cell growth
Inclusion body formationMisfolding, overexpression- Reduce induction level
- Co-express with chaperones
- Use solubility-enhancing tags
- Increased portion in soluble fraction
- Functional assays showing activity
Poor extraction efficiencyInadequate detergent, strong membrane association- Screen detergent panel
- Optimize detergent:protein ratio
- Try SMA copolymers
- Increased yield in detergent extract
- Homogeneous SEC peak
Aggregation during purificationDetergent incompatibility, lipid removal- Include lipids during purification
- Add stabilizing ligands
- Optimize buffer composition
- Monodisperse SEC profile
- Consistent activity measurements

Success with membrane proteins often requires iterative optimization at each step. The approaches used successfully for ABCB10, the first human ABC transporter to produce diffracting crystals , provide a valuable template for working with y4tQ.

What bioinformatic approaches can identify potential functional partners and evolutionary relationships of y4tQ?

Understanding the functional context and evolutionary history of y4tQ requires sophisticated bioinformatic analyses:

  • Genomic Context Analysis:

    • Examination of gene neighborhood on pNGR234a to identify operonic structures

    • Identification of co-occurring genes across different Rhizobium species

    • Analysis of regulatory elements in the promoter region

  • Protein-Protein Interaction Prediction:

    • Identification of other ABC transporter components likely to form functional complexes with y4tQ

    • Structural modeling of potential interactions using homology models

    • Co-evolution analysis to identify residues involved in protein-protein interactions

  • Phylogenetic Analysis:

    • Construction of maximum likelihood trees using homologous sequences

    • Analysis of selection pressure on different protein domains

    • Identification of conserved motifs and variable regions

  • Structural Prediction and Comparison:

    • Homology modeling based on available ABC transporter structures

    • Analysis of conservation mapping onto structural models

    • Molecular dynamics simulations to investigate conformational dynamics

  • Substrate Prediction:

    • Machine learning approaches using physicochemical properties of known substrates

    • Binding site prediction and virtual screening

    • Comparison with experimentally characterized transporters

Table 5: Evolutionary Conservation of Key Functional Regions in y4tQ Homologs

Functional RegionConservation LevelPotential SignificanceAnalysis Method
Transmembrane domainsHighCore structural elements essential for transport functionHydrophobicity analysis, multiple sequence alignment
Substrate binding pocketModerate to VariableSubstrate specificity determinationConservation mapping on homology models
Coupling helices (interfacing with NBDs)HighEssential for communicating conformational changesStructural modeling, co-evolution analysis
Extracellular loopsVariablePotentially involved in substrate recognition or regulationSelection pressure analysis (dN/dS ratios)
Cytoplasmic loopsModerateInteraction with cytoplasmic componentsProtein-protein interaction prediction

The exceptional number of secretion systems in NGR234 provides an interesting evolutionary context for y4tQ. Comparative genomic analysis across Rhizobium species with different host ranges could reveal how y4tQ may have evolved in relation to symbiotic capabilities and host specificity.

How might y4tQ be utilized in biocontrol applications for agricultural improvement?

Recent research has identified specific Rhizobium strains effective against soybean root rot fungal pathogens . The y4tQ protein, as part of the symbiotic machinery of Rhizobium sp. NGR234, could potentially play a role in similar biocontrol applications:

  • Mechanisms of Biocontrol Potential:

    • If y4tQ is involved in transport of antimicrobial compounds, engineered expression could enhance biocontrol capabilities

    • The protein might participate in competitive exclusion of pathogens through enhanced colonization

    • Transported substrates might include signaling molecules that induce plant defense responses

  • Engineering Approaches:

    • Overexpression of y4tQ in promising biocontrol strains like TZSR12C, TZSR25B, and TZSR41A

    • Construction of chimeric transporters combining domains from y4tQ with those of transporters known to be involved in antagonism

    • Modification of substrate specificity through targeted mutagenesis

  • Field Application Methodologies:

    • Seed coating with engineered strains expressing optimized y4tQ variants

    • Soil inoculation strategies to maximize root colonization

    • Combination with other biocontrol agents for synergistic effects

Table 6: Potential Biocontrol Applications Based on ABC Transporter Functions

FunctionMechanismEngineering ApproachExpected Outcome
Antimicrobial compound exportDirect antagonism of pathogensOverexpression, promoter engineeringEnhanced zone of inhibition against pathogens
Siderophore transportCompetition for ironModification of substrate specificityReduced iron availability for pathogens
Quorum sensing molecule transportDisruption of pathogen communicationEngineering to recognize pathogen signalsInterference with pathogen virulence
Plant defense elicitor transportInduction of systemic resistanceCo-expression with elicitor production genesEnhanced plant resistance to multiple pathogens

It's worth noting that any biocontrol application would require extensive testing under controlled and field conditions. The identification of specific rhizobia strains effective against soybean root rot provides a valuable foundation for such studies, potentially incorporating engineered y4tQ variants to enhance biocontrol efficacy.

What approaches can elucidate the structural dynamics of y4tQ during the transport cycle?

Understanding the conformational changes that occur during the transport cycle is crucial for elucidating the mechanism of y4tQ function. Advanced methodologies that can capture these dynamics include:

  • Time-Resolved Structural Methods:

    • Time-resolved cryo-EM to capture different conformational states

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions with changing solvent accessibility during the transport cycle

    • Single-molecule FRET to monitor real-time conformational changes

  • Computational Approaches:

    • Molecular dynamics simulations at extended timescales to capture conformational transitions

    • Enhanced sampling techniques (metadynamics, umbrella sampling) to overcome energy barriers

    • Markov state modeling to identify key intermediate states

  • Spectroscopic Methods:

    • Double electron-electron resonance (DEER) EPR spectroscopy with strategically placed spin labels, as used with P-gp

    • Solid-state NMR to probe specific interactions and dynamics

    • Vibrational spectroscopy to monitor changes in secondary structure

  • Functional Dynamics Assays:

    • ATPase activity measurements under various conditions to correlate structural changes with energetics

    • Transport assays with real-time monitoring to link conformational changes to substrate movement

    • Accessibility studies using cysteine-reactive probes, similar to approaches used with MsbA

Table 7: Key Conformational Transitions Expected During y4tQ Transport Cycle

TransitionStructural ChangesDetection MethodFunctional Significance
Inward-facing to occludedClosure of cytoplasmic gateDEER EPR measurements of cytoplasmic domain distancesSubstrate binding and initial transport
Occluded to outward-facingOpening of extracellular gateAccessibility changes measured by cysteine labelingSubstrate release
ATP bindingNBD dimerization, conformational changes in coupling helicesFRET between labeled NBDs and TMDsEnergetic coupling
ATP hydrolysisReset to inward-facing conformationTime-resolved structural methodsCompletion of transport cycle

These approaches can be complemented by the XF-MS technique mentioned by Bavro , which offers valuable insights into the dynamics of membrane proteins and can identify structural waters critical for conformational changes.

How does y4tQ potentially interact with other secretion systems in Rhizobium sp. NGR234?

Rhizobium sp. strain NGR234 encodes more different secretion systems than any other known rhizobia and probably most known bacteria, with 132 genes and proteins linked to secretory processes . The potential interactions between y4tQ and these diverse secretion systems represent an intriguing area of research:

  • Coordinated Regulation:

    • Analysis of transcriptional regulation to identify co-regulated secretion systems

    • Investigation of potential master regulators controlling multiple secretion pathways

    • Characterization of environmental stimuli that trigger differential expression

  • Functional Complementarity:

    • Identification of substrates that might be processed sequentially by different transport systems

    • Analysis of potential redundancy or specialization among transport pathways

    • Investigation of synergistic effects on symbiotic processes

  • Physical Interactions:

    • Co-immunoprecipitation studies to identify physical interactions between components of different systems

    • Bacterial two-hybrid screens to map interaction networks

    • Fluorescence co-localization to detect spatial organization of transport machineries

Table 8: Known Secretion Systems in NGR234 and Potential Interactions with y4tQ

Secretion SystemNumber in NGR234Potential Functional Relationship with y4tQResearch Approach
Type I transportersSix genesPossible substrate overlap or sequential processingSubstrate profiling, double mutant analysis
Type III systemsOne functional, one putativeCoordination in host interactionCo-expression analysis, symbiotic phenotyping
Type IV attachment systemsThree systemsSpatial coordination during host interactionLocalization studies, interaction mapping
Type IV conjugation piliTwo putative systemsTemporal segregation of functionsTime-course expression analysis
Twin arginine translocasePresentComplementary substrate specificityComparative substrate analysis

The exceptional diversity of secretion systems in NGR234 suggests a sophisticated division of labor in managing interactions with the environment and host plants. Understanding how y4tQ fits into this complex network could provide insights into the remarkable host range and adaptability of this organism.

What role might y4tQ play in the metabolism of aromatic compounds by Rhizobium sp. NGR234?

Rhizobium sp. NGR234 carries genes and regulatory networks linked to the metabolism of a wide range of aromatic and nonaromatic compounds, allowing it to quickly adapt to changing environmental stimuli in soils, rhizospheres, and plants . The y4tQ protein might contribute to this metabolic versatility:

  • Transport of Aromatic Compounds:

    • Investigation of y4tQ's ability to transport plant-derived aromatic compounds like flavonoids

    • Analysis of growth phenotypes of y4tQ mutants on different aromatic carbon sources

    • Metabolomic profiling to identify accumulation or depletion of specific compounds

  • Role in Plant-Microbe Signaling:

    • Characterization of y4tQ involvement in transport of plant-derived signals

    • Analysis of response to flavonoids and phytoalexins in y4tQ mutants

    • Investigation of potential role in quorum-sensing signal transport, given NGR234's six loci linked to quorum-sensing signal quenching

  • Contribution to Metabolic Adaptation:

    • Transcriptomic analysis of y4tQ expression under different aromatic compound exposures

    • Comparative growth studies between wild-type and y4tQ mutants under various conditions

    • Identification of metabolic pathways affected by y4tQ mutation

Table 9: Potential Aromatic Substrates for y4tQ Based on Rhizobium sp. NGR234 Metabolism

Compound ClassExamplesRelevance to Rhizobium BiologyDetection Methods
FlavonoidsNaringenin, Genistein, DaidzeinNod gene induction, chemotaxisLC-MS, growth assays, reporter gene expression
Phenolic acidsp-Coumaric acid, Ferulic acidCarbon sources, plant defenseRadioisotope uptake, growth phenotypes
PhytoalexinsGlyceollin, MedicarpinPlant defense responseResistance profiling, transcriptional response
Quorum-sensing moleculesAcyl-homoserine lactonesPopulation regulationBiosensor assays, signal accumulation measurement

The extensive array of mono- and dioxygenases (more than 30 ORFs) in NGR234 suggests a sophisticated system for metabolizing aromatic compounds. If y4tQ is involved in transporting these compounds, it would represent an important link between uptake and metabolic processing.

What are the critical quality control steps for working with recombinant y4tQ protein?

Ensuring the quality and functional integrity of recombinant y4tQ protein is essential for reliable experimental results. A comprehensive quality control framework includes:

  • Purity Assessment:

    • SDS-PAGE analysis with both Coomassie staining and Western blotting

    • Mass spectrometry to confirm protein identity and detect modifications

    • Size exclusion chromatography to assess aggregation state

    • Dynamic light scattering to evaluate homogeneity

  • Structural Integrity:

    • Circular dichroism spectroscopy to confirm secondary structure content

    • Thermal stability assays to assess protein folding

    • Limited proteolysis to detect misfolded regions

    • Negative stain EM to visualize protein particles

  • Functional Verification:

    • ATPase activity assays (if co-purified with NBD components)

    • Substrate binding assays using fluorescence or other detection methods

    • Reconstitution into liposomes and transport assays

    • Interaction assays with known partner proteins

  • Long-term Stability Assessment:

    • Storage condition optimization (temperature, buffer components)

    • Regular testing of activity after different storage periods

    • Freeze-thaw stability evaluation

    • Monitoring of oxidation and other chemical modifications

Table 10: Troubleshooting Guide for Common Quality Issues with Recombinant Membrane Proteins

Quality IssueDetection MethodPotential CausesSolutions
AggregationSEC profile, DLS measurementsDetergent depletion, lipid removal- Add fresh detergent
- Include lipids
- Optimize buffer composition
Proteolytic degradationWestern blot, mass spectrometryContaminating proteases, flexible regions- Add protease inhibitors
- Identify and remove flexible regions
- Optimize purification speed
Loss of activityFunctional assaysDenaturation, cofactor loss, oxidation- Include stabilizing ligands
- Add reducing agents
- Optimize storage conditions
HeterogeneitySEC-MALS, native PAGEMultiple conformations, partial unfolding- Add stabilizing ligands
- Further purification steps
- Engineering stable constructs

Rigorous quality control is particularly important for membrane proteins like y4tQ, as they are inherently less stable outside their native membrane environment. The approaches used in structural studies of other ABC transporters, such as those described for CFTR preparation , provide valuable guidelines.

How can researchers design effective chimeric constructs to study specific aspects of y4tQ function?

Chimeric protein constructs offer powerful tools for dissecting the structure-function relationships of y4tQ. Strategic design considerations include:

  • Domain Swapping Approaches:

    • Replacing transmembrane helices to investigate substrate specificity

    • Swapping extracellular loops to study recognition mechanisms

    • Exchanging cytoplasmic domains to analyze coupling with NBDs

    • Creating fusions with well-characterized transporters of known function

  • Reporter Fusions:

    • Split GFP complementation to detect protein-protein interactions

    • FRET pairs positioned to report on conformational changes

    • pH-sensitive fluorophores to monitor transport-associated pH changes

    • Luciferase fusions for high-throughput screening assays

  • Topology Mapping Constructs:

    • Insertion of epitope tags at predicted loop regions

    • PhoA/LacZ fusions to determine membrane orientation

    • Accessibility mapping using cysteine scanning mutagenesis

    • Insertion of cleavage sites for topology verification

  • Functional Complementation Designs:

    • Creation of minimal functional units to identify essential domains

    • Cross-species complementation to test evolutionary conservation

    • Rescue constructs for phenotypic analysis in knockout backgrounds

    • Inducible expression systems for temporal control

Table 11: Strategic Design of Chimeric y4tQ Constructs for Functional Analysis

Chimera TypeDesign StrategyExpected InformationValidation Methods
Substrate specificity chimerasSwap TMDs with related transporters of known specificityIdentification of specificity-determining regionsTransport assays with defined substrates
Conformational reporter constructsInsert FRET pairs at dynamic interfacesReal-time monitoring of conformational changesEnergy transfer efficiency measurements
Interaction mapping constructsFuse split reporter proteins to potential interaction partnersIdentification of interaction networksFluorescence/luminescence complementation
Cross-species functional chimerasReplace domains with orthologues from other speciesEvolutionary conservation of functionPhenotypic complementation tests

When designing chimeric constructs, it's crucial to consider domain boundaries to minimize disruption of protein folding. Structural information from related ABC transporters, combined with bioinformatic predictions of domain organization, can guide rational design decisions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.