The recombinant Rhizobium sp. Probable translocation protein y4yN (NGR_a00590) is a bioengineered version of a bacterial protein encoded by the NGR_a00590 gene in Rhizobium sp. strain NGR234. This protein is associated with symbiotic processes and protein secretion mechanisms. Its full-length sequence spans 272 amino acids (1-272aa) and includes an N-terminal His tag for purification purposes .
| Property | Details |
|---|---|
| Gene Name | NGR_a00590 |
| ORF Name | y4yN |
| UniProt ID | P55722 |
| Expression Host | E. coli |
| Tag Type | N-terminal His tag |
| Purity | >90% (SDS-PAGE) |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer, 6% trehalose, pH 8.0 |
The recombinant protein is produced in E. coli due to its high yield and faster turnaround compared to other hosts like yeast or insect cells . Its amino acid sequence is:
MYLSPAEIQILLHAAIELVAAAGLGAARALGIMLILPVFTRSQIGGLIRGCLAIAFGLPC LAHVSDGLQAPDPETSLIQIPLLGLKEVFVGVLLGTFLGIPLWGLQAAGEFIDNQRGITS PSTQADPATNSQASAMGVFLGITAITIFVAAGGVEAVLSALYGSYSIWPVYRFQPTLSTQ GAVELFGLLDHIMRTTLLVSGPVVFFLGLIDISMMMLRRFAPQFKSGQLSPPIKNIVFPI IMVTYATYLLEGIKLEITQADGTLGWLDKLLK .
NGR_a00590 is part of the symbiotic plasmid in Rhizobium sp. NGR234, which is critical for nodulation and nitrogen fixation in legume hosts . While its exact function remains under investigation, genetic context suggests involvement in:
Protein Translocation: Homology to secretion-related ORFs (e.g., y4yl, y4yK) linked to the type III secretion system (TTSS) .
Symbiotic Regulation: Located near regulatory elements like nod boxes, which are binding sites for transcriptional activators (e.g., NodD) .
The protein is typically expressed in E. coli due to cost-effectiveness and scalability. Post-expression, the His tag enables affinity chromatography purification, yielding >90% pure product .
TTSS Involvement: Rhizobia’s TTSS shares homology with pathogenic bacteria’s secretion systems, suggesting conserved mechanisms for protein translocation .
Symbiotic Specificity: Mutations in TTSS components (e.g., rhcN) disrupt nodulation, highlighting y4yN’s potential role in host-specific interactions .
Structural Insights: The His-tagged recombinant protein facilitates crystallization studies to elucidate translocation mechanisms .
KEGG: rhi:NGR_a00590
Recombinant Rhizobium sp. Probable translocation protein y4yN (NGR_a00590) is a bacterial protein encoded by the NGR_a00590 gene in Rhizobium sp. strain NGR234 (also referenced as Sinorhizobium fredii strain NBRC 101917/NGR234). The protein is classified as a probable translocation protein, suggesting its potential involvement in protein transport mechanisms .
The significance of this protein lies in understanding bacterial translocation processes, particularly in the context of Rhizobium-legume symbiotic relationships. While the specific function of y4yN remains under investigation, research on translocation proteins in Rhizobium species has revealed their critical roles in symbiotic interactions and nitrogen fixation processes .
Multiple expression systems can be utilized for the production of Recombinant y4yN (NGR_a00590), each with distinct advantages depending on research requirements:
| Expression System | Advantages | Considerations | Optimal Applications |
|---|---|---|---|
| E. coli | Highest yields, shorter turnaround times, cost-effective | May lack some post-translational modifications | Structural studies, antibody production |
| Yeast | Good yields, some post-translational modifications | More complex than bacterial systems | Functional studies requiring moderate modifications |
| Insect cells with baculovirus | Many post-translational modifications | Longer production time, more expensive | Studies requiring authentic folding patterns |
| Mammalian cells | Most complete post-translational modifications | Most complex system, highest cost | Interactions with mammalian proteins, activity assays |
E. coli and yeast systems are particularly recommended for initial studies due to their balance of yield and turnaround time . For studies requiring authentic protein activity, insect cell or mammalian expression systems may be preferable to ensure proper post-translational modifications and protein folding essential for biological function .
To maintain protein integrity and functionality, follow these evidence-based storage and handling protocols:
Short-term storage (up to one week): Store working aliquots at 4°C to minimize freeze-thaw cycles
Long-term storage: Store at -20°C for routine preservation, or at -80°C for extended storage periods
Buffer composition: Typically provided in Tris-based buffer with 50% glycerol to stabilize protein structure
Freeze-thaw considerations: Avoid repeated freezing and thawing which can lead to protein denaturation and loss of activity
Preparation before use: Briefly centrifuge vials prior to opening to bring contents to the bottom
For reconstitution of lyophilized protein, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (final concentration) before aliquoting for long-term storage .
Multiple analytical techniques should be employed in combination to establish both identity and purity:
SDS-PAGE: For purity assessment, aim for >85% purity as typically verified by SDS-PAGE
Western Blotting: Using antibodies specific to either y4yN or tag epitopes (if present)
Mass Spectrometry:
MALDI-TOF analysis to confirm molecular weight
Peptide mass fingerprinting following tryptic digest to confirm sequence identity
N-terminal Sequencing: To verify protein identity and check for proper processing of any signal sequences
Size Exclusion Chromatography: To assess aggregation state and homogeneity
For membrane proteins like y4yN, additional verification may include detergent-phase partitioning assays to confirm proper folding of hydrophobic regions. When conducting advanced functional studies, it's advisable to implement activity assays specific to translocation function, though standardized assays for y4yN are still being developed.
To study the function of y4yN in Rhizobium symbiosis, consider the following experimental design approaches based on successful methodologies used with similar proteins:
Genetic Mutation Studies:
Create a nonpolar mutant of y4yN using marker exchange methodology similar to that employed for other Rhizobium proteins
Perform triparental mating for genetic transfer, using helper plasmids such as pRK2013
Confirm mutations by Southern blotting of restricted genomic DNA
Include complementation studies by reintroducing the wild-type gene on a plasmid vector
Symbiosis Phenotype Analysis:
Conduct nodulation tests using a range of host legumes in controlled environments such as Magenta jars
Quantify nodule formation at 6 weeks post-inoculation
Assess effectiveness of nodules through sectioning and microscopy
Isolate bacteria from nodules to confirm strain identity through antibiotic resistance profiling
Ultrastructural Analysis:
Examine infected nodule cells using electron microscopy to assess symbiosome formation
Compare wild-type and mutant strains to identify specific defects in symbiotic development
Look for abnormalities in infection thread formation, bacteroid differentiation, and symbiosome membrane integrity
When designing these experiments, it's crucial to include appropriate controls (wild-type, complemented mutant, and other related mutants) to distinguish the specific effects of y4yN from those of other proteins. Based on studies with related proteins like Y4lO, attention should be paid to potential effects on symbiosome differentiation and senescence patterns in nodules .
Developing and utilizing recombinant antibodies for y4yN detection requires systematic approach:
Generation of Specific Antibodies:
Consider human scFv antibody technology through phage display, which has been successfully employed for other Rhizobium proteins
Screen phage clones by phage ELISA against both boiled and non-boiled cell preparations to identify antibodies recognizing conformational versus linear epitopes
Express selected scFv in non-suppressor E. coli strains such as HB2151 or in other expression systems for antibody production
Detection Methodology Development:
ELISA Protocols:
Optimize coating conditions (typically 1-10 μg/mL of purified protein or bacterial lysate)
Determine optimal antibody dilutions through titration experiments
Develop both direct and sandwich ELISA formats depending on application
Immunofluorescent Staining:
For detection in plant tissue, fix samples with paraformaldehyde or glutaraldehyde
Optimize permeabilization conditions to access bacterial proteins within plant cells
Use appropriate secondary antibodies conjugated with fluorophores suitable for your imaging system
Include DAPI staining to visualize bacterial and plant cell nuclei
Immunogold Labeling for Electron Microscopy:
These methodologies have been successful in detecting other Rhizobium proteins in both symbiotic associations with legumes and endophytic associations with non-leguminous plants like rice .
While specific functional studies on y4yN (NGR_a00590) are still emerging, several hypotheses can be formulated based on research with other translocation proteins in Rhizobium species:
Hypothesis 1: Involvement in Type III Secretion System (T3SS)
Given its classification as a probable translocation protein, y4yN may function as part of the T3SS machinery, similar to other proteins like NopB in Rhizobium sp. NGR234. The T3SS delivers proteins called Nodulation Outer Proteins (Nops) outside the bacterial cell, affecting host-specific nodulation . The protein could be involved in the assembly or function of the secretion apparatus, potentially affecting the delivery of effector proteins.
Hypothesis 2: Role in Symbiosome Development
Studies with the Y4lO protein of Rhizobium sp. strain NGR234 have shown that some proteins are involved in symbiosome differentiation. Y4lO affected the transition from infection droplets to symbiosomes containing single bacteroids . By analogy, y4yN might play a role in symbiotic organelle development or bacteroid differentiation.
Hypothesis 3: Modulation of Host Responses
Some secreted proteins from rhizobia function to suppress or modulate host defense responses, allowing successful colonization. The y4yN protein might function similarly to YopJ-family effectors (to which Y4lO shows similarity) that often target host signaling pathways .
Hypothesis 4: Membrane-Associated Transport Functions
Based on its amino acid sequence containing potential membrane-spanning regions, y4yN might function in transport processes across bacterial membranes, potentially facilitating nutrient exchange in the symbiotic state.
Research approaches to test these hypotheses would include mutation analysis combined with detailed phenotypic characterization of symbiotic interactions, localization studies using tagged proteins or specific antibodies, and identification of potential interaction partners through techniques such as co-immunoprecipitation or yeast two-hybrid screening.
Systematic mutagenesis approaches can provide valuable insights into y4yN function:
Site-Directed Mutagenesis Strategy:
Target Selection Based on Sequence Analysis:
Identify conserved regions by alignment with related proteins
Predict functional domains using bioinformatics tools
Focus on potential membrane-spanning regions and charged residues at interfaces
Mutation Types to Consider:
Alanine scanning of conserved residues
Conservative vs. non-conservative substitutions
Domain swapping with related proteins
Truncation mutations to identify minimal functional units
Experimental Workflow:
Construct Generation:
Introduction into Rhizobium:
Complementation Controls:
Functional Analysis Framework:
Assess growth characteristics in free-living state
Evaluate symbiotic phenotypes with multiple host plants
Examine protein localization using tagged constructs
If secretion is affected, analyze secretome changes
For a mutation approach similar to that used for NopB in Rhizobium sp. NGR234, consider inserting a reporter gene (such as uidA) into y4yN and using marker exchange to create insertion mutants . This approach allows both functional studies and tracking of gene expression patterns.
Advanced techniques for studying translocation properties should focus on protein localization, interaction partners, and functional characteristics:
Membrane Association and Topology:
Membrane Fractionation:
Separate bacterial membranes using ultracentrifugation
Western blot analysis of fractions to determine localization
Protease Protection Assays:
Treat intact cells or membrane preparations with proteases
Analyze protected fragments to determine protein topology
Site-Specific Photocross-linking:
Protein-Protein Interactions:
Co-Immunoprecipitation with Related Proteins:
Use antibodies against known translocation system components
Identify co-precipitating proteins by mass spectrometry
Bacterial Two-Hybrid Analysis:
Screen for interactions with other membrane or secretion components
Validate interactions using pull-down assays with purified components
Proximity Labeling Techniques:
Fuse y4yN to BioID or APEX2 for proximity-dependent labeling
Identify neighboring proteins in the native membrane environment
Functional Translocation Assays:
In Vitro Translocation Systems:
Reconstitute translocation using purified components in proteoliposomes
Measure transport of model substrates across membranes
Fluorescent Reporter Fusions:
Create fusions with split fluorescent proteins
Monitor translocation events in real-time in living cells
Electrophysiological Measurements:
If y4yN forms channels, use planar lipid bilayer recordings
Characterize channel properties and regulation
These approaches have been successfully applied to study other translocation systems and can be adapted for investigating y4yN. Studies on the Sec61p complex have demonstrated that detergent-solubilized translocation components retain functionality, suggesting that similar approaches might be applicable to bacterial translocation proteins like y4yN .
While specific phylogenetic analyses of y4yN are not detailed in the provided search results, we can extrapolate from evolutionary patterns observed with related translocation proteins:
Evolutionary Context:
The y4yN gene is located on plasmid pNGR234a of Rhizobium sp. strain NGR234, similar to other symbiosis-related genes
Many rhizobial secretion and translocation components show homology to virulence factors in pathogenic bacteria, suggesting common evolutionary origins despite different functional outcomes
The naming convention (y4xx) is used for several genes in Rhizobium sp. NGR234, many of which encode proteins of specialized function in symbiosis
Comparative Analysis Approach:
For researchers interested in conducting evolutionary analyses of y4yN, the following methodological approach is recommended:
Sequence Alignment and Phylogenetic Analysis:
Use tools like CLUSTAL Omega for multiple sequence alignment
Employ maximum likelihood or Bayesian methods for tree construction
Include diverse translocation proteins from both symbiotic and pathogenic bacteria
Domain Architecture Analysis:
Identify conserved domains and motifs using tools like InterPro or SMART
Compare domain organization across protein families
Synteny Analysis:
Examine genomic context of y4yN and related genes
Identify conserved gene neighborhoods that might indicate functional relationships
Selection Pressure Analysis:
Calculate dN/dS ratios to identify regions under purifying or diversifying selection
Compare with other translocation proteins to identify functionally important regions
This evolutionary perspective can provide valuable context for understanding the specialized roles of translocation proteins in different bacterial species and their adaptation to various ecological niches, from pathogenesis to symbiosis.
Several cutting-edge technologies show promise for elucidating the function of y4yN and similar translocation proteins:
Cryo-Electron Microscopy:
Advanced cryo-EM techniques could reveal the three-dimensional structure of y4yN within the membrane context, providing insights into its mechanism of action. Recent advances allowing visualization of membrane proteins in native-like environments are particularly relevant.
AlphaFold and Machine Learning Approaches:
Deep learning models for protein structure prediction can generate testable hypotheses about y4yN structure and function, particularly useful when combined with experimental validation approaches.
Single-Molecule Tracking:
Techniques utilizing fluorescent protein fusions and super-resolution microscopy could track y4yN dynamics in living bacteria during symbiotic interactions, revealing spatial and temporal aspects of its function.
CRISPR-Cas9 Based Technologies:
Precision genome editing in both bacteria and host plants could facilitate more sophisticated functional studies, including conditional mutations and tagged endogenous proteins.
Multi-omics Integration:
Combining transcriptomics, proteomics, and metabolomics data from wild-type and mutant strains under various conditions could place y4yN in broader cellular networks.
Microfluidics and Live Imaging:
Microfluidic devices that mimic the rhizosphere environment, combined with advanced imaging, could allow real-time observation of y4yN activity during host interaction.
These technologies, when applied systematically, hold promise for resolving the functional role of y4yN in Rhizobium biology and symbiotic interactions.