Recombinant Rhizobium sp. Putative exopolysaccharide production repressor protein y4xQ (NGR_a00830)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we are happy to accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a00830; y4xQ; Putative exopolysaccharide production repressor protein y4xQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a00830
Target Protein Sequence
MSFGIFHRILWLFLCANTLIVYLVTGSISDAVVTTMVGSLLLQLTYFANVLFLLWRAHCA RRARQTTGQFHGEEQPGDPRIAGTHGRTDGDPCFEDEDSR
Uniprot No.

Target Background

Function
This protein may be involved in inhibiting exopolysaccharide synthesis (EPS) and nodulation ability (nod).
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does y4xQ relate to the broader context of Rhizobium-legume symbiosis?

The y4xQ protein likely plays a role in regulating exopolysaccharide (EPS) production, which is critical for rhizobial adaptation during different stages of symbiosis with legumes. Rhizobia undergo dramatic lifestyle and developmental changes during symbiosis, transitioning from soil-dwelling bacteria to symbionts that fix nitrogen within plant nodules .

Exopolysaccharides are known to be essential for successful root colonization and nodulation processes. As a putative repressor of EPS production, y4xQ may help regulate the timing and amount of EPS synthesis during different stages of symbiotic development, potentially influencing recognition by the plant, attachment to roots, infection thread formation, and ultimately bacteroid differentiation .

What expression systems are used for recombinant production of y4xQ?

The recombinant y4xQ protein is typically produced using Escherichia coli expression systems. Commercial preparations of this protein are available as His-tagged recombinant proteins expressed in E. coli . The full-length protein (amino acids 1-100) can be fused with an N-terminal His tag for purification purposes . This expression system allows for efficient production and purification of the protein for research applications.

What are the optimal storage conditions for recombinant y4xQ protein?

For optimal stability and activity retention, recombinant y4xQ protein should be stored according to the following guidelines:

Storage ConditionRecommendationDuration
Long-term storage-20°C or -80°CMonths to years
Working aliquots4°CUp to one week
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0 or Tris-based buffer with 50% glycerol-

It's crucial to avoid repeated freeze-thaw cycles as they can significantly reduce protein activity and integrity. For extended storage, aliquoting the protein solution is necessary to minimize freeze-thaw events .

What is the recommended reconstitution protocol for lyophilized y4xQ protein?

When working with lyophilized preparations of y4xQ protein, follow this reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to ensure all material is at the bottom

  • Reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for long-term storage

This protocol helps maintain protein stability and functional integrity for downstream applications.

What functional assays can be employed to study y4xQ's repressor activity?

To investigate the repressor function of y4xQ on exopolysaccharide production, researchers can employ several methodological approaches:

  • Gene expression analysis: Quantify expression levels of EPS biosynthesis genes in the presence and absence of functional y4xQ using RT-qPCR or RNA-Seq

  • Promoter reporter assays: Fuse promoters of EPS biosynthesis genes to reporter genes (e.g., GFP, lacZ) and measure activity with and without y4xQ expression

  • EPS quantification assays: Compare EPS production in wild-type strains versus y4xQ mutants using carbohydrate quantification methods such as:

    • Anthrone-sulfuric acid method for total carbohydrate content

    • Size exclusion chromatography for EPS molecular weight distribution

    • Monosaccharide composition analysis using HPLC or GC-MS

  • DNA-protein interaction studies: Investigate direct binding of y4xQ to regulatory regions of EPS genes using:

    • Electrophoretic mobility shift assays (EMSA)

    • Chromatin immunoprecipitation (ChIP)

    • DNase I footprinting

These methodological approaches can help elucidate the specific mechanisms by which y4xQ regulates EPS production in Rhizobium.

How can transposon-insertion sequencing approaches be adapted to study y4xQ function in symbiosis?

Mariner-based transposon insertion sequencing (INSeq) has proven valuable for characterizing the fitness contribution of rhizobial genes during symbiosis . To adapt this approach specifically for y4xQ functional studies:

  • Generate comprehensive transposon libraries: Create mariner transposon insertion libraries in Rhizobium sp. NGR234 background

  • Design stage-specific screens: Assess the effect of y4xQ mutations at multiple developmental stages:

    • Rhizosphere growth

    • Root colonization

    • Undifferentiated nodule bacteria

    • Terminally differentiated bacteroids

  • Conditional expression systems: Complement the screens with conditional expression of y4xQ to determine stage-specific requirements

  • Comparative genomics approach: Compare the fitness effects of y4xQ mutations with other known EPS regulators to establish genetic networks

  • Data analysis pipeline: Implement computational approaches to identify genetic interactions between y4xQ and other genes required for symbiosis

This methodology would allow researchers to determine if y4xQ is categorized as rhizosphere-progressive (required in the rhizosphere and subsequent stages), stage-specific (required at particular developmental stages), or adaptation-dispensable (not required under the conditions tested) .

What is the relationship between y4xQ and other EPS regulatory systems in Rhizobium?

Investigating the relationship between y4xQ and other EPS regulatory systems requires integrated research approaches:

  • Comparative genetic analysis: Compare the regulatory roles of y4xQ with other known EPS regulators in Rhizobium, such as:

    • RopB (RL1589) and RopA (RL2775), which encode outer membrane amyloid fibrils involved in attachment

    • The NtrB/NtrC two-component regulatory system (RL2256/RL2257) that responds to nitrogen limitation

    • The RNA polymerase sigma factor 54 (RL0422, rpoN)

  • Signaling pathway elucidation: Determine whether y4xQ functions within established signaling cascades or represents an independent regulatory mechanism

  • Protein-protein interaction studies: Identify potential interaction partners of y4xQ using:

    • Yeast two-hybrid screening

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid systems

  • Interspecies comparison: Analyze the conservation and functional divergence of y4xQ across different Rhizobium species and strains

Understanding these relationships would provide insights into the complex regulatory networks governing EPS production during different stages of the Rhizobium-legume symbiosis.

How does host plant species influence y4xQ expression and function?

The influence of host plant species on y4xQ expression and function represents an important research direction:

  • Comparative transcriptomics: Analyze y4xQ expression patterns when Rhizobium sp. NGR234 interacts with different legume hosts

  • Host-specific mutant phenotypes: Compare the symbiotic performance of y4xQ mutants across multiple host plants to identify:

    • Host-specific requirements for EPS regulation

    • Differential effects on nodulation efficiency

    • Variations in nitrogen fixation capacity

  • Plant signal response: Investigate how plant-derived compounds affect y4xQ expression:

    • Test the effects of root exudates from different host plants

    • Identify specific plant signals that modulate y4xQ expression

    • Compare with known plant rescue pathways for auxotrophic rhizobia

  • Co-evolution analysis: Examine the co-evolutionary relationships between y4xQ sequence variation and host plant preferences across Rhizobium species

This research would help elucidate the role of y4xQ in host-specific adaptation of Rhizobium species.

What are common challenges in generating functional y4xQ mutants?

Researchers face several technical challenges when attempting to create and study functional y4xQ mutants:

  • Gene essentiality considerations: If y4xQ has essential functions, complete knockouts may not be viable, requiring:

    • Conditional mutant systems

    • Partial deletion strategies

    • Point mutations that affect function but not viability

  • Polar effects: Since bacterial genes often exist in operons, mutations in y4xQ might affect downstream genes. Strategies to address this include:

    • Using non-polar cassettes for gene disruption

    • Complementation with the isolated gene on a plasmid

    • Site-specific mutagenesis approaches

  • Functional redundancy: Other genes may compensate for y4xQ function, masking phenotypes. Approaches to overcome this include:

    • Multiple gene knockouts

    • Overexpression studies

    • Synthetic lethality screens

  • Phenotype detection: EPS-related phenotypes may be subtle or condition-dependent, requiring:

    • Sensitive quantification methods

    • Testing under various environmental stresses

    • Competitive fitness assays rather than direct growth measurements

How can protein solubility issues with recombinant y4xQ be addressed?

Improving the solubility of recombinant y4xQ protein requires systematic optimization:

  • Expression conditions optimization:

    • Test multiple E. coli strains (BL21, Rosetta, Arctic Express)

    • Vary induction temperatures (16°C, 25°C, 30°C, 37°C)

    • Adjust inducer concentration and induction duration

    • Explore auto-induction media formulations

  • Fusion tags selection:

    • Compare solubility with different tags (His, GST, MBP, SUMO)

    • Evaluate N-terminal versus C-terminal tag positioning

    • Consider dual tagging approaches

  • Buffer composition screening:

    • Test various pH conditions (pH 6.0-9.0)

    • Evaluate different salt concentrations (50-500 mM NaCl)

    • Add stabilizing agents (glycerol, trehalose, arginine)

    • Include mild detergents if membrane-associated properties are suspected

  • Co-expression approaches:

    • Co-express with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Co-express with known interaction partners

These approaches can significantly improve the yield of functional, soluble y4xQ protein for biochemical and structural studies.

What structural biology approaches could elucidate y4xQ function?

Advancing our understanding of y4xQ function through structural biology would benefit from:

  • High-resolution structure determination:

    • X-ray crystallography of purified y4xQ

    • NMR spectroscopy for dynamic regions analysis

    • Cryo-EM for larger complexes with interaction partners

  • Structural predictions and modeling:

    • Homology modeling based on related repressor proteins

    • Molecular dynamics simulations to predict conformational changes

    • Protein-DNA docking to identify potential binding sites

  • Structure-function relationship studies:

    • Site-directed mutagenesis of predicted functional domains

    • Truncation analysis to identify minimal functional units

    • Cross-linking studies to capture transient interactions

  • In situ structural analysis:

    • Super-resolution microscopy to track y4xQ localization

    • Chemical cross-linking mass spectrometry (XL-MS) to identify neighbors

    • Protein painting approaches to map accessible surfaces

These structural approaches would provide crucial insights into the molecular mechanisms of y4xQ's repressor function.

How can systems biology approaches integrate y4xQ function into broader symbiotic networks?

Systems biology offers powerful frameworks to contextualize y4xQ function:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Map changes in EPS composition and structure to gene expression profiles

    • Identify metabolic consequences of altered EPS production

  • Network analysis:

    • Construct gene regulatory networks centered on y4xQ

    • Identify hub genes that connect EPS regulation to other symbiotic processes

    • Model the temporal dynamics of these networks during symbiosis progression

  • Predictive modeling:

    • Develop mathematical models of EPS production regulation

    • Simulate the effects of environmental perturbations

    • Predict the consequences of genetic modifications

  • Evolutionary systems biology:

    • Compare regulatory networks across related Rhizobium species

    • Identify conserved and divergent aspects of EPS regulation

    • Relate network architecture to host range and symbiotic efficiency

These integrative approaches would help position y4xQ within the complex adaptive processes that enable successful Rhizobium-legume symbiosis .

What implications does y4xQ research have for improving symbiotic nitrogen fixation?

Research on y4xQ has potential applications for enhancing biological nitrogen fixation:

  • Engineering improved symbiotic efficiency:

    • Optimize EPS production through targeted modification of y4xQ

    • Engineer strains with enhanced competitiveness in the rhizosphere

    • Develop rhizobial inoculants with improved survival and nodulation capacity

  • Expanding host range:

    • Modify EPS regulatory systems to overcome host compatibility barriers

    • Engineer strains capable of forming effective symbioses with non-traditional hosts

    • Develop strategies to outcompete indigenous soil bacteria

  • Environmental adaptation:

    • Enhance rhizobial tolerance to environmental stressors through EPS modifications

    • Improve persistence in agricultural soils

    • Develop strains adapted to changing climate conditions

  • Fundamental knowledge advancement:

    • Deepen understanding of molecular dialogue between plants and bacteria

    • Identify new targets for enhancing symbiotic interactions

    • Elucidate evolutionary processes driving host-microbe co-adaptation

These applications highlight the potential for basic research on proteins like y4xQ to contribute to sustainable agricultural practices through improved biological nitrogen fixation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.