Recombinant Rhizobium sp. Putative uncharacterized transketolase family protein y4mO (NGR_a02440)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing. The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
NGR_a02440; y4mO; Putative uncharacterized transketolase family protein y4mO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-279
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02440
Target Protein Sequence
MAQIGHNISLPERARRIRRHALRMGEVQGQGYIAQALGIADVLAVAYFHATTYRPDDPEW EGRDRFLLSIGHYAIALYAALIEAKIIPEDELETYGADDSRLPMSGMAAYTPGMEITGGS LGHGLGIAVGMSLALKRKGSRSFVYNLFSDGELDEGSTWEAAMSAGSYKLDNLIGIVDVN QMQADGPSLGVLNFEPLGPKFEAFGWYVQRIDGNDIDALVDAFDNARQHRHPQPRIIICD TKMAKGVPFLEARERNHFLRVEPQEWAEAIRIIDAGVTA
Uniprot No.

Target Background

Database Links
Protein Families
Transketolase family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does y4mO compare to other characterized transketolases?

While specific comparative data for y4mO is limited due to its uncharacterized status, we can draw parallels with well-studied transketolases:

Featurey4mO (NGR_a02440)E. coli TransketolaseHuman Transketolase
Length279 amino acids Typically ~680 amino acids~623 amino acids
CofactorPredicted ThDP-binding motifsThiamine diphosphate (ThDP) Thiamine diphosphate (ThDP)
FunctionUncharacterized, potential role in carbohydrate metabolismCatalyzes sugar interconversion in pentose phosphate pathway Carbon transfer in pentose phosphate pathway
Catalytic mechanismUnknownFormation of covalent intermediate with ThDP cofactor ThDP activation involves His110
Structural featuresPredicted catalytic domainsWell-characterized with three transitions in denaturation pathway ThDP binding in "V form" with self-stabilization role

The significantly shorter length of y4mO (279 aa) compared to typical transketolases (~600-700 aa) suggests it may represent a partial or specialized domain of the transketolase family rather than a complete canonical transketolase enzyme . Research approaches would need to account for these structural differences when investigating potential catalytic activities.

What are the recommended protocols for recombinant production and purification of y4mO?

Based on established protocols for similar proteins, the following methodological approach is recommended for recombinant production and purification of y4mO:

Expression System and Vector Design:

  • Host organism: Escherichia coli, which has been successfully used for y4mO expression .

  • Vector selection: Vectors containing strong inducible promoters (e.g., T7) with N-terminal His-tag for purification .

  • Construct design: The gene sequence should be codon-optimized for E. coli expression, with appropriate restriction sites for cloning into the selected vector.

Expression Protocol:

  • Transform the expression construct into a suitable E. coli strain (e.g., BL21(DE3)).

  • Grow transformed cells in LB medium with appropriate antibiotics at 37°C until OD600 reaches 0.6-0.8.

  • Induce protein expression with IPTG (typically 0.1-1.0 mM) and continue cultivation at lower temperatures (16-30°C) to enhance proper folding.

  • Harvest cells by centrifugation and resuspend in lysis buffer containing protease inhibitors.

Purification Strategy:

  • Cell lysis: Sonication or high-pressure homogenization in buffer compatible with subsequent purification steps.

  • Affinity chromatography: Ni-NTA or similar matrix for His-tagged protein .

  • Buffer exchange: Into Tris/PBS-based storage buffer, pH 8.0 .

  • Additional purification (if needed): Size exclusion chromatography to ensure homogeneity.

  • Quality assessment: SDS-PAGE and activity assays to confirm purity (>90% is typically achievable) .

Storage Recommendations:

  • For long-term storage: Lyophilized powder or in 50% glycerol at -20°C/-80°C .

  • Working aliquots can be maintained at 4°C for up to one week .

  • Avoid repeated freeze-thaw cycles as this may compromise protein stability .

What methodological approaches are suitable for functional characterization of y4mO?

Given the uncharacterized nature of y4mO, a systematic multi-pronged approach is necessary for functional characterization:

Structural Analysis:

  • X-ray crystallography or cryo-EM to determine three-dimensional structure.

  • Computational modeling based on homology with known transketolases.

  • Identification of potential cofactor binding sites, especially for thiamine diphosphate (ThDP).

Biochemical Characterization:

  • Cofactor binding assays to confirm ThDP interaction.

  • Substrate screening using a panel of potential substrates based on known transketolase reactions.

  • Enzyme kinetics assays to determine catalytic parameters (Km, kcat, substrate specificity).

Genetic Approaches:

  • Gene knockout or CRISPR-Cas9 editing in Rhizobium sp. NGR234 to assess phenotypic effects.

  • Complementation studies to verify function.

  • Transcriptional analysis to identify co-regulated genes and potential metabolic pathways.

Metabolomics Integration:

  • Metabolite profiling of wild-type versus y4mO-deficient strains.

  • Isotope-labeled substrate feeding experiments to track carbon flux.

  • Analysis of metabolite exchange during plant-microbe symbiosis.

Protein-Protein Interaction Studies:

  • Pull-down assays with His-tagged y4mO to identify interaction partners.

  • Bacterial two-hybrid screening for potential protein complexes.

  • Co-immunoprecipitation studies in native Rhizobium sp. NGR234.

This methodological framework provides a comprehensive approach to unraveling the functional role of y4mO, from basic structural characteristics to complex metabolic interactions within the symbiotic context.

What structural features of y4mO might inform its potential catalytic mechanism?

While the three-dimensional structure of y4mO remains undetermined, sequence analysis and comparisons with characterized transketolases provide insights into potential structural features that may inform its catalytic mechanism:

Predicted Structural Elements:

  • Based on homology to transketolases, y4mO likely contains domains for thiamine diphosphate (ThDP) binding, which is essential for catalytic activity in transketolase family enzymes .

  • The sequence may include predicted catalytic domains typical of transketolases, such as thiamine pyrophosphate-binding motifs necessary for cofactor interaction.

  • At 279 amino acids, y4mO is significantly shorter than canonical transketolases (~600-700 aa), suggesting it may represent a specialized domain or have a more focused catalytic function .

Potential Catalytic Mechanism:

  • If functioning similarly to characterized transketolases, y4mO would likely catalyze reactions via formation of a covalent intermediate between a ketol moiety and the thiazole ring of the ThDP cofactor .

  • The reaction mechanism would involve:

    • Deprotonation of C2 of the ThDP thiazole ring

    • Nucleophilic attack on the carbonyl carbon of the ketose substrate

    • Formation of a covalent ThDP-substrate adduct

    • Transfer of the ketol unit to an acceptor aldose

Structural Stability Considerations:
Research on E. coli transketolase has revealed three transitions in the denaturation pathway for holo-TK, which might be relevant to y4mO stability :

  • Local restructuring of ThDP binding sites at low denaturant concentrations

  • Dissociation of cofactors and partial loss of secondary structure

  • Complete unfolding of the enzyme

For experimental verification of these structural predictions, approaches such as circular dichroism (CD) spectroscopy, fluorescence intensity measurements, and size-exclusion chromatography could be employed to analyze cofactor binding and structural transitions, similar to methods used with E. coli transketolase .

How might computational approaches predict the function and substrates of y4mO?

Computational approaches offer powerful tools for predicting the function and potential substrates of uncharacterized proteins like y4mO. The following methodological framework is recommended:

Sequence-Based Analyses:

  • Phylogenetic analysis to position y4mO within the transketolase family evolutionary context.

  • Motif scanning to identify conserved catalytic residues and substrate-binding domains.

  • Remote homology detection using position-specific scoring matrices (PSSMs) or hidden Markov models (HMMs).

Structural Prediction and Analysis:

  • Homology modeling using characterized transketolases as templates (e.g., E. coli or human transketolase).

  • Molecular dynamics simulations to assess structural stability and flexibility.

  • Analysis of potential binding pockets and catalytic sites.

Quantum Mechanics/Molecular Mechanics (QM/MM) Approach:
Similar to studies on human transketolase , QM/MM calculations could:

  • Predict cofactor activation mechanisms (e.g., ThDP activation).

  • Model the complete catalytic cycle with potential substrates.

  • Identify key residues involved in substrate binding and catalysis.

Metabolic Context Analysis:

  • Genome context analysis to identify neighboring genes and potential metabolic pathways.

  • Metabolic network modeling to predict substrate and product connections.

  • Integration with transcriptomic data to identify co-expression patterns.

Virtual Screening for Substrate Prediction:

  • Docking simulations with a library of potential substrates based on pentose phosphate pathway intermediates.

  • Binding energy calculations to rank potential substrates.

  • Molecular interaction analysis to predict substrate specificity determinants.

The insights gained from these computational approaches can guide experimental design for biochemical characterization and provide testable hypotheses about the functional role of y4mO in Rhizobium sp. metabolism and symbiotic interactions.

What potential roles might y4mO play in Rhizobium-legume symbiosis?

The genomic context of y4mO on the symbiotic plasmid pNGR234a suggests potential involvement in symbiotic processes. Several hypothetical roles can be proposed based on current knowledge:

Carbon Metabolism During Symbiosis:

  • Rhizobium sp. strain NGR234 forms nitrogen-fixing nodules with over 110 legume genera, requiring significant metabolic adaptation.

  • As a putative transketolase family protein, y4mO may participate in carbohydrate metabolism remodeling during nodule formation and maintenance.

  • It could facilitate the interconversion of sugar phosphates to optimize carbon utilization from plant photosynthates within the specialized symbiotic environment.

Signaling and Host Range Determination:

  • The location of y4mO on pNGR234a, which contains other symbiotic genes including nodulation factors and Type III secretion system components, suggests potential involvement in host interaction pathways .

  • It may contribute to metabolite-based signaling between the symbiotic partners, potentially influencing host specificity.

Stress Adaptation During Symbiosis:

  • Transketolases in the pentose phosphate pathway generate NADPH, which is crucial for managing oxidative stress .

  • y4mO might play a role in redox homeostasis within nodules, where reactive oxygen species management is critical for symbiotic success.

Integration with Nitrogen Fixation Metabolism:

  • The genome organization of Rhizobium sp. NGR234 shows distribution of symbiotic genes across replicons, with fixation-related genes on the chromosome and nodulation genes on plasmids .

  • y4mO may represent a metabolic link between carbon processing and nitrogen fixation pathways.

To experimentally investigate these potential roles, researchers could employ:

  • Comparative metabolomics between wild-type and y4mO mutant strains during symbiosis.

  • Transcriptional analysis to identify co-regulation with known symbiotic genes.

  • Isotope labeling studies to trace carbon flux through pentose phosphate pathway intermediates during nodulation.

  • Plant phenotyping assays to assess the impact of y4mO mutation on symbiotic efficiency across different host legumes.

How might y4mO interact with other enzymes in metabolic pathways?

Understanding the potential metabolic interactions of y4mO requires consideration of its position within the broader enzymatic network of Rhizobium sp. The following methodological approaches can reveal these interactions:

Predicted Pathway Integration:

  • As a putative transketolase family protein, y4mO likely participates in pathways involving sugar phosphate interconversions, potentially including:

    • Pentose phosphate pathway

    • Calvin-Benson cycle

    • Entner-Doudoroff pathway variants

  • Given its location on the symbiotic plasmid, it may interact with specialized metabolic enzymes involved in symbiosis-specific processes .

Potential Enzyme Interaction Partners:

  • Other enzymes in carbon metabolism pathways, particularly those involved in handling C5-C7 sugars.

  • Enzymes involved in nucleotide biosynthesis, which depends on pentose phosphate pathway intermediates.

  • Regulatory proteins that coordinate carbon metabolism with symbiotic processes.

Experimental Approaches to Identify Interactions:

  • Protein-Protein Interaction Studies:

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Bacterial two-hybrid screening

    • Proximity-dependent biotin identification (BioID)

  • Metabolic Flux Analysis:

    • 13C-labeled substrate feeding and metabolite tracking

    • Quantification of flux alterations in y4mO mutants

    • Integration with computational metabolic models

  • Comparative Omics Approaches:

    • Transcriptomics to identify co-expressed genes

    • Proteomics to detect changes in enzyme abundance

    • Metabolomics to identify altered metabolite pools

  • Synthetic Biology Testing:

    • Reconstitution of minimal pathways in heterologous systems

    • Testing of enzyme combinations for emergent activities

    • Pathway complementation studies across species boundaries

These methodological approaches can reveal both direct physical interactions and functional metabolic connections, providing a comprehensive understanding of how y4mO operates within the broader enzymatic network of Rhizobium sp. during both free-living and symbiotic phases.

What biotechnological applications might be developed based on y4mO properties?

While y4mO remains uncharacterized, its classification within the transketolase family suggests several potential biotechnological applications based on the known capabilities of related enzymes:

Biocatalysis for Stereoselective Synthesis:
Transketolases are valuable biocatalysts for stereo-specific carbon-carbon bond formation, which is crucial in pharmaceutical and fine chemical synthesis . If y4mO possesses such activity, it could be developed for:

  • Synthesis of chiral building blocks for pharmaceuticals with high stereoselectivity

  • Production of rare sugars and sugar derivatives

  • Green chemistry applications requiring carbon-carbon bond formation under mild conditions

Metabolic Engineering Applications:

  • Enhancement of carbon flux through engineered pathways in industrial microorganisms

  • Optimization of pentose utilization in biofuel-producing organisms

  • Development of novel pathways for valorization of agricultural waste streams

Agricultural Applications:
Given its presence in a symbiotic nitrogen-fixing bacterium, y4mO might be exploited for:

  • Development of improved Rhizobium inoculants with enhanced metabolic capabilities

  • Engineering of broader host-range nitrogen-fixing bacteria

  • Creation of synthetic plant-microbe interactions with optimized nutrient exchange

Methodological Approach for Application Development:

  • Enzyme Characterization and Engineering:

    • Determination of substrate scope and catalytic parameters

    • Protein engineering for enhanced stability or altered specificity

    • Immobilization strategies for industrial applications

  • Process Development:

    • Optimization of reaction conditions (pH, temperature, cofactor recycling)

    • Scale-up studies for industrial relevance

    • Integration with existing biocatalytic cascades

  • System Biology Integration:

    • Incorporation into metabolic models of industrial organisms

    • Prediction of flux optimization strategies

    • Assessment of global metabolic impacts

Understanding the structural stability of y4mO under various conditions would be essential for optimizing these applications, similar to the approach taken with E. coli transketolase to improve its utility in biocatalytic processes .

What advanced structural analysis techniques would be most informative for studying y4mO?

Understanding the structure-function relationship of y4mO requires sophisticated structural analysis techniques. The following methodological approaches would provide complementary insights:

High-Resolution Structural Determination:

  • X-ray Crystallography:

    • Provides atomic-level resolution of protein structure

    • Particularly valuable for capturing cofactor binding modes

    • Can visualize the active site architecture essential for catalytic mechanism elucidation

    • Challenge: Obtaining well-diffracting crystals may require extensive crystallization screening

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of protein in near-native conditions without crystallization

    • Particularly useful if y4mO forms larger complexes with interaction partners

    • Modern techniques can achieve near-atomic resolution

    • Advantage: Requires less protein than crystallography and avoids crystallization artifacts

Dynamic Structural Analysis:

  • Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein dynamics and solvent accessibility

    • Identifies regions undergoing conformational changes upon cofactor or substrate binding

    • Provides insights into protein breathing motions relevant to catalysis

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • For studying dynamics of specific domains or residues

    • Can investigate cofactor binding and conformational changes in solution

    • Particularly valuable for investigating the ThDP binding and activation

Computational Integration:

  • Molecular Dynamics Simulations:

    • To model protein flexibility and conformational states

    • For investigating the impact of mutations on protein stability and function

    • Can provide insights into substrate binding pathways and product release

  • QM/MM Studies:

    • Similar to the approach used for human transketolase

    • For detailed modeling of catalytic mechanisms

    • Can predict the energetics of different reaction steps and transition states

Advanced Biophysical Techniques:

These complementary approaches would provide a comprehensive structural understanding of y4mO, from static atomic-level details to dynamic conformational changes relevant to its catalytic function and stability under various conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.