Recombinant Rhizobium sp. Uncharacterized ABC transporter ATP-binding protein y4gM (NGR_a03510)

Shipped with Ice Packs
In Stock

Description

Introduction to the Protein

Recombinant Rhizobium sp. Uncharacterized ABC Transporter ATP-Binding Protein y4gM (NGR_a03510) is a prokaryotic ATP-binding cassette (ABC) transporter subunit expressed in Escherichia coli for research applications. This protein, encoded by the NGR_a03510 locus in Sinorhizobium fredii (strain NGR234), belongs to the ABC transporter superfamily, which facilitates substrate translocation across cellular membranes using ATP hydrolysis . While its specific physiological role remains uncharacterized, ABC transporters typically function in nutrient uptake, metabolite efflux, or stress response .

Primary Structure

  • Amino Acid Sequence: Comprises 586 residues (UniProt ID: P55469), with conserved motifs critical for ATP binding, including Walker A (P-loop), Walker B, and ABC signature motifs .

  • Domain Architecture: Predicted to adopt the canonical ABC ATPase fold, featuring nucleotide-binding domains (NBDs) that dimerize upon ATP binding .

Post-Translational Features

  • Tag: N-terminal His tag for purification .

  • Molecular Weight: Approximately 65–70 kDa (calculated from sequence) .

ParameterDetails
Source OrganismSinorhizobium fredii (strain NGR234)
Expression SystemEscherichia coli
Protein LengthFull-length (1–586 aa)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose

Functional Insights

ABC transporters like NGR_a03510 operate through conformational changes driven by ATP binding and hydrolysis . Key features include:

  • ATP-Binding Mechanism: ATP binding at the NBD dimer interface stabilizes the transporter’s outward-facing conformation, enabling substrate translocation .

  • Substrate Specificity: While uncharacterized, homology suggests potential roles in amino acid or ion transport, analogous to related Rhizobium ABC transporters .

  • Bidirectional Transport: Some ABC importers in Rhizobia exhibit bidirectional solute movement, balancing uptake and efflux .

  • Structural Studies: Serves as a model for probing ABC transporter mechanics using techniques like cryo-EM or X-ray crystallography .

  • Mechanistic Analysis: AlphaFold-Multimer predictions (pLDDT >90) suggest utility in studying Type I/II importer dynamics .

  • Biotechnological Potential: Could inform synthetic biology efforts to engineer nutrient uptake systems in symbiotic bacteria .

Future Directions

Further studies are needed to:

  • Elucidate substrate specificity via ligand-binding assays.

  • Characterize conformational transitions using spectroscopic methods.

  • Explore regulatory domains potentially influencing ATPase activity .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you require a specific format, please specify your preference during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time information.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please communicate your request in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
NGR_a03510; y4gM; Uncharacterized ABC transporter ATP-binding protein y4gM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-586
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03510
Target Protein Sequence
MLQKFISKSNQSLLMRLLAENFKHQAPWYGIAIGSMVVVAVMTSASAWIMRDVVNSTVVS KDIEKVFGVAVTVAIIFAVKGLATYVQSIFLSKAGNNIIAHTQRRLFEHVLRQGLSFYSI YPSSELLVRLTNNAQAVRSVIELVVTSFIRDLFSLMGLLAVMVIQQPLLSLVSAAVGPGA ILGVRVLTRKVRKIMELEIASIGQIIQSVQETSTGIRIVKAFALEDFMRRRMDKYIGDVE RRANSIARLEAASSPIMETLSGFAIAGVIALSGVLVLQQGNTPGELMSFITALLLAYEPA KRLARMRISLESALVGVRMMYQLADHPIELTEKNSAIPLPEGPGEIRFKDVNFSYKNGER LFQNLNVTFPAGKTTALVGPSGAGKSSIINLIMRLYDPDVGSVTVDGHDLKDVTFRSLRD RIGFVGQDTFLFSGTIKYNISLGREGASDEEIIEAAKTANAHDFIMKMPHGYDTEVGENG IKLSGGQKQRITIARAMLRNAEILIFDEATSALDSESEIQIRQALARLTRKRTTIMIAHR LSTVTAADNIVVMEGGQVAEQGPQGRLLSQDGVYRRLYELQLLPSA
Uniprot No.

Target Background

Database Links
Protein Families
ABC transporter superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are T3 effector proteins in Rhizobium sp. and how do they affect nodulation?

T3 effector proteins are molecules secreted by nitrogen-fixing rhizobia through the bacterial Type III Secretion System (T3SS) that significantly impact the nodulation process with specific host legumes. These proteins can function as either positive or negative regulators of nodule formation, similar to how T3 effectors in pathogenic bacteria can act as virulence or avirulence factors .

In Rhizobium sp. strain NGR234, the T3SS plays a crucial role in nodulation of certain host plants including Tephrosia vogelii, Phaseolus vulgaris, Pachyrhizus tuberosus, Crotalaria juncea, and Flemingia congesta . The expression of genes encoding the T3SS depends on host flavonoids, the transcriptional regulator NodD1, and the transcriptional activator TtsI .

Research methodology: To study how T3 effectors affect nodulation, researchers typically create mutant strains with disrupted effector genes and compare their nodulation phenotypes with wild-type strains across different host plants. Microscopic analysis of nodule development and ultrastructural studies provide detailed insights into how these proteins influence symbiotic relationships.

How is the expression of symbiotic proteins regulated in Rhizobium sp.?

The expression of symbiotic proteins in Rhizobium sp. is regulated through a sophisticated signaling cascade that begins with plant-derived flavonoids. These compounds serve as primary signals that induce rhizobial genes essential for symbiosis . The activation of these genes depends on NodD transcriptional regulators that bind to conserved DNA sequences called nod boxes .

In the case of T3SS genes in NGR234, the regulation follows a hierarchical pattern. Flavonoids activate NodD1, which induces the expression of TtsI through binding to a nod box in its promoter region. TtsI then activates the transcription of T3SS genes and effector proteins .

For the Y4lO protein specifically, transcription studies demonstrated that its promoter activity depends on the transcriptional activator TtsI . This was verified using transcriptional fusion experiments with the promoterless gusA gene, allowing quantitative measurement of promoter activity in response to flavonoid induction .

What are the similarities between Y4lO and other effector proteins in pathogenic bacteria?

Y4lO in Rhizobium sp. strain NGR234 shares sequence similarities with proteins belonging to the YopJ effector family found in pathogenic bacteria . Members of this family have been identified in various pathogenic bacteria including:

  • Yersinia sp. (YopJ/YopP)

  • Salmonella enterica serovar Typhimurium (AvrA)

  • Vibrio parahaemolyticus (VopA)

  • Xanthomonas campestris pv. vesicatoria (AvrRxv, AvrBsT, AvrXv4, and XopJ)

  • Erwinia amylovora (ORFB)

  • Pseudomonas syringae (ORF5, AvrPpiG)

  • Ralstonia solanacearum (PopP1, PopP2)

Despite these similarities, Y4lO appears to have different substrate specificities. Studies showed that recombinant Y4lO protein expressed in Escherichia coli did not acetylate representative mitogen-activated protein kinase kinases (human MKK6 and MKK1 from Medicago truncatula) . This suggests functional divergence between YopJ-like proteins in pathogenic and symbiotic bacteria, highlighting the importance of experimental verification rather than relying solely on sequence homology for functional prediction.

How do mutagenesis approaches reveal the symbiotic functions of Rhizobium effector proteins?

Mutagenesis approaches provide critical insights into protein function by comparing wild-type strains with mutants lacking specific proteins. For Y4lO, researchers employed targeted gene disruption to create the mutant strain NGRΩ y4lO . They also generated a double mutant (NGRΩ nopLΩ y4lO) lacking both Y4lO and another T3 effector, NopL .

The methodology involves:

  • Creating precise mutations in the gene of interest

  • Verifying mutations through sequencing

  • Comparing nodulation phenotypes across multiple host plants

  • Conducting ultrastructural analysis of nodules

This approach revealed that Y4lO plays a critical role in symbiosome differentiation. Plants inoculated with NGRΩ y4lO initially formed pink nodules that rapidly turned greenish, indicating premature senescence. Ultrastructural analysis showed abnormal formation of enlarged infection droplets in these ineffective nodules . Notably, the double mutant NGRΩ nopLΩ y4lO formed effective pink nodules similar to the wild-type strain, suggesting that Y4lO counteracts the senescence-inducing effects of NopL .

What biochemical activities have been investigated for YopJ-like proteins and how might this inform studies of Y4lO?

The biochemical activities of YopJ-like proteins have been subject to evolving understanding. Initially thought to function as cysteine proteases with conserved active site residues (H, D/E, Q, C), transient expression studies suggested deubiquitinating enzyme activity for YopJ and AvrA, while SUMO protease activity was proposed for AvrXv4 .

For Y4lO specifically, researchers tested whether it could acetylate two representative mitogen-activated protein kinase kinases (human MKK6 and MKK1 from Medicago truncatula) and found that it did not . This suggests that Y4lO may have different substrate specificities or biochemical activities compared to other YopJ-like proteins.

Research methodology: To investigate the biochemical activity of Y4lO, researchers could:

  • Express and purify recombinant Y4lO

  • Test its activity on various potential substrates relevant to symbiotic signaling

  • Use mass spectrometry to identify post-translational modifications on substrate proteins

  • Perform site-directed mutagenesis of putative catalytic residues to confirm their involvement

How does the secretion of Nops influence symbiotic relationships with different legume hosts?

The secretion of Nops (nodulation outer proteins) through the T3SS significantly impacts the symbiotic relationships between Rhizobium sp. and various legume hosts, with effects that vary depending on the host species . Nops can function as either positive or negative regulators of nodulation, similar to how T3 effectors in pathogenic bacteria can act as virulence or avirulence factors .

NopB is a particularly interesting example, as it is required for the secretion of other Nops but has different effects on different host plants. Research has shown that NopB inhibits the interaction with Pachyrhizus tuberosus while augmenting nodulation of Tephrosia vogelii . Similarly, Y4lO has been identified as a symbiotic determinant involved in the differentiation of symbiosomes and mitigates senescence-inducing effects caused by another T3 effector, NopL .

These findings illustrate the complex and host-specific roles of T3 effectors in symbiotic relationships. A single effector protein can have positive effects on one host plant while negatively impacting another, highlighting the specificity of plant-microbe interactions in the Rhizobium-legume symbiosis.

What transcriptional and translational fusion techniques are useful for studying protein expression in Rhizobium sp.?

Transcriptional and translational fusions represent powerful tools for studying the expression patterns and regulation of proteins in Rhizobium sp. For Y4lO, researchers employed both approaches to understand its regulation :

  • Transcriptional fusion: A 870-bp fragment containing the putative promoter region of y4lO was inserted upstream of the promoterless gusA gene of vector pRG960, yielding plasmid pRG-y4lOp . This allowed researchers to monitor promoter activity by measuring β-glucuronidase (GUS) activity.

  • Translational fusion: An 891-bp fragment containing the promoter region of y4lO and 138 bp of the coding region was fused to gusA without the ATG start codon, creating plasmid pRG-891 . This construct enabled the study of both transcriptional and translational regulation.

These constructs were introduced into wild-type NGR234 and a TtsI mutant (NGRΩttsI) to investigate the dependence of y4lO expression on the TtsI transcriptional activator . GUS activity was measured fluorometrically after induction with the flavonoid apigenin, providing quantitative data on expression levels.

This methodology effectively demonstrated that the promoter activity of y4lO depended on the transcriptional activator TtsI, confirming its regulation as part of the T3SS regulon .

What bioinformatic tools are essential for analyzing Rhizobium proteins?

Several bioinformatic tools proved valuable for the analysis of Y4lO and related proteins in Rhizobium sp. The following tools and their applications were documented in the research :

  • Neural Network Promoter Prediction (NNPP) version 2.2 - Used for analyzing the promoter region of y4lO to identify potential promoter elements.

  • GeneMark version 2.5 - Applied for the identification of alternative start codons, crucial for determining the correct protein sequence.

  • Compute pI/M tool - Utilized to calculate the molecular weights of predicted proteins.

  • BLAST program - Essential for sequence comparisons with databases to identify homologous proteins.

  • Clustal W algorithm - Used for aligning Y4lO homologues (amino acid sequences).

  • MEGA3.1 program - Employed to construct phylogenetic trees using the neighbor-joining method, helping to visualize evolutionary relationships between Y4lO and related proteins.

  • MYR prediction server - Used for analyzing the amino acid sequence of short ORFs for potential myristoylation sites.

This comprehensive bioinformatic approach allows researchers to predict protein properties, identify regulatory elements, and establish evolutionary relationships, providing a foundation for experimental investigations .

How can proteomics approaches overcome the challenges of detecting low-abundance secreted proteins?

A significant challenge in studying secreted proteins like Nops is their low abundance in the supernatants of Rhizobium strains grown in culture . To address this limitation, researchers developed a more sensitive proteomics-based strategy:

  • Comparative two-dimensional gel electrophoresis: Secreted proteins from wild-type NGR234 were separated by two-dimensional gel electrophoresis and compared to similar gels containing proteins from a TTSS mutant (NGRΩrhcN) .

  • Mass spectrometry analysis: Spots unique to the NGR234 gels were analyzed by matrix-assisted laser desorption ionization-time of flight (MALDI-TOF) mass spectrometry .

  • Database comparison: The mass spectrometry data were compared to the sequence of the symbiotic plasmid of NGR234 to identify the proteins .

This approach allowed researchers to identify NopB, a protein required for Nop secretion that affects nodulation in a host-specific manner . The methodology demonstrates how combining gel-based separation with mass spectrometry and genome sequence data can overcome the challenges of detecting low-abundance proteins in complex biological samples.

What approaches can be used to investigate the structural components of Rhizobium secretion systems?

To investigate the structural components of the T3SS in Rhizobium sp. NGR234, researchers employed several complementary approaches:

  • In situ immunogold labeling: This technique allowed researchers to visualize NopB in surface appendages (pili) of NGR234 . By using antibodies specific to NopB conjugated with gold particles, they could localize the protein within the bacterial surface structures using electron microscopy.

  • Isolation and characterization of pili: Researchers isolated the surface appendages and analyzed their composition, confirming that they contain NopB . This approach provided direct evidence of the protein's incorporation into extracellular structures.

  • Flavonoid induction studies: The research demonstrated that flavonoids and a functional TTSS are required for the formation of some surface appendages on NGR234 . By comparing wild-type bacteria with TTSS mutants, and examining the effects of flavonoid induction, researchers established the conditions necessary for the formation of these structures.

These methodologies collectively provided insights into how the T3SS components assemble to form functional secretion apparatus, highlighting the importance of combining structural, genetic, and biochemical approaches to understand complex bacterial secretion systems.

What are the key unanswered questions about T3 effector proteins in Rhizobium sp.?

Despite significant advances in understanding T3 effector proteins in Rhizobium sp., several important questions remain unanswered:

  • While it's hypothesized that rhizobial T3 effectors are delivered into legume host cells, direct evidence for this translocation is still lacking . Developing methods to track protein movement from bacteria to plant cells would significantly advance our understanding of T3 effector function.

  • The precise biochemical activities and host cell targets of many T3 effectors, including Y4lO, remain undefined. While Y4lO has sequence similarities to acetyltransferases like YopJ, it did not acetylate tested kinases , suggesting it may have different substrates or activities.

  • The complex interplay between different T3 effectors, such as the synergistic relationship between Y4lO and NopL , requires further investigation to understand how these proteins collectively influence symbiotic outcomes.

  • The evolutionary origin of T3 effectors in rhizobia and their relationship to similar proteins in pathogenic bacteria present interesting questions about how symbiotic bacteria may have repurposed virulence factors for beneficial interactions.

Future methodological approaches should focus on comprehensive proteomic analyses of infected nodule cells, improved techniques for tracking protein translocation, and systems biology approaches to understand the complex network of interactions between multiple bacterial effectors and host proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.