Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH (NGR_a00280)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhizobium sp. Uncharacterized Protein y4bA/y4pH (NGR_a00280)

Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH (NGR_a00280) is a full-length protein derived from Rhizobium sp. strain NGR234. Designated by multiple identifiers (NGR_a00280, y4bA, y4pH), it spans 694 amino acids and is fused to an N-terminal His tag for purification purposes . This recombinant version is expressed in E. coli and purified to >90% homogeneity via SDS-PAGE .

AttributeValueSource
Gene NameNGR_a00280
Synonymsy4bA, y4pH, NGR_a02040
UniProt IDP55368
Protein Length1–694 aa (Full Length)
Expression HostE. coli
TagN-terminal His tag

Genomic Context and Symbiotic Plasmid Associations

The protein y4bA/y4pH is encoded by the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234, a strain known for its broad host range in legume symbiosis . Key genomic insights include:

  • Plasmid Organization: pNGR234a contains open reading frames (ORFs) involved in nitrogen fixation, nodulation, secretion, and plasmid replication .

  • Functional Clusters:

    • Nodulation: ORFs like y4yC and y4yH are linked to nodulation processes .

    • Secretion Systems: ORFs y4yI and y4yO are associated with protein secretion, potentially involving type III secretion pathways .

  • Replication and Transfer: The plasmid’s origin of replication (oriV) and origin of transfer (oriT) share homology with Agrobacterium Ti-plasmids and Rhizobium leguminosarum plasmids, highlighting conserved mechanisms in conjugation and plasmid stability .

Functional Insights and Potential Roles

While y4bA/y4pH remains uncharacterized, its genomic context suggests involvement in symbiotic interactions. Key hypotheses include:

  • Symbiotic Regulation: Proximity to a nod box upstream of ORF y4xI implies potential interaction with transcriptional regulators like NodD1, which controls nodulation gene expression .

  • Surface Polysaccharide Modulation: Plasmid-encoded ORFs in pNGR234a regulate exopolysaccharide (EPS) biosynthesis, a critical factor in host-bacterium recognition . Though not directly linked to y4bA/y4pH, its presence on the plasmid suggests indirect roles in EPS-related symbiotic processes .

  • Protein Secretion: ORFs y4yI/y4yO encode components of secretion systems, aligning with the plasmid’s role in delivering effector proteins during infection thread formation .

Applications in Symbiosis Research

Recombinant y4bA/y4pH is employed to study:

  • Protein Interactions: Identifying binding partners in nodulation or secretion pathways.

  • Structural Biology: Elucidating conformational dynamics critical for symbiotic functions.

  • Functional Genomics: Testing hypotheses about plasmid-encoded ORFs in symbiosis .

Critical Knowledge Gaps and Future Directions

Despite its availability, the precise function of y4bA/y4pH remains unresolved. Priorities include:

  • Functional Annotation: CRISPR-Cas9 knockout studies in Rhizobium sp. NGR234 to link gene deletion with phenotypic changes.

  • Protein Crystallography: Structural analysis to infer enzymatic or regulatory roles.

  • Host Interaction Studies: Testing recombinant protein binding to plant receptors (e.g., EPR3) involved in infection thread guidance .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NGR_a00280; y4bA; NGR_a02040; y4pH; Uncharacterized protein y4bA/y4pH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-694
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a00280
Target Protein Sequence
MSTDIAIKVDADHLRRDAFLYVRQSSLRQVFENTESTKRQYALRDRAVALGWPIERVHVI DSDLGLSGAQSQDRDGFQHLVSEVAMGHAGIVLGLEVSRLARNNADWHRLLELAALSRTL IMDEDGVYDPAYFNDRMLLGLKGTMSEAELHILKSRLQGGILNKARRGELEMPLPIGLVY TPDARVVLDPDRQIQDTVRLLFDTFRQTGSACAVVRRLRGEKILFPRRIRRGIGKGDVLW NEIDHSRVLQILHNPRYAGAFAYGRTRTAYNAKLKPVQLRVARSDWQVLIPDAHDGYISW AEYERNQAALEQNATGFSPGLRGRMPRQGSGLLQGRLLCGRCGARMRVHYEPFEGRLRPY YVCNEAVVRHAGKHCQWVRGAPVDEAVSALLLEVMAPAAIDVALAVQQEITQRVEQAAAL RGTQLQRARYEAELARRRYLKVDPDNRLVADALEADWNARLRDLDALQREHERQNEADHS LLDEPAQQRIRALTADFPRIWNDERTGAVERKRMLGLLIEDVTLLVDDEVNINIRWRGGR TQSLSVARPRPMSVIRKTPAQVVALINELLEATNDRQIAARLNELGHRNWRGEPFTPKKV MLVRRTYGLKSRYERLREGGMLTGEEVAQQLGVCESTVHQLGRKGTLKRHRYASNHRYLY EPPGNVRLEKGAGSRYGGRQPRLIVAQPLQQGAS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH (NGR_a00280)?

Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH (NGR_a00280) is a manufactured protein derived from Rhizobium species, specifically expressed using recombinant technology to produce the partial protein designated as NGR_a00280 . This protein belongs to the broader category of recombinant proteins, which are manufactured proteins produced using cells programmed to express the protein of interest . As an "uncharacterized" protein, its complete function and structural characteristics have not been fully elucidated, presenting opportunities for novel research investigations. The protein is derived from Rhizobium, a genus of gram-negative soil bacteria known for forming nitrogen-fixing nodules on the roots of leguminous plants .

How does Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH compare to other Rhizobium proteins?

The uncharacterized protein y4bA/y4pH (NGR_a00280) is one of several proteins isolated from Rhizobium species. A related protein, the Uncharacterized protein y4kH (NGR_a02880), has a defined amino acid sequence (MRERAVGSKG SFPIGIAELQ EVSCASVEIN QPLLLADLRS DGMLRMRIPT DAARAASHEL GKQWSRALWL HDEKPDGIIY DSRLNGEANT ALFDRALPKL NVKSSGPLLD FRDEVAQILD DFSLEIV) and is available as a full-length protein expressed in yeast . While both belong to the category of uncharacterized Rhizobium proteins, they likely serve different functions within the bacterium. Comparative analysis between these proteins may provide insights into the functional diversity of Rhizobium proteins and their potential roles in plant-microbe interactions . Researchers should consider employing sequence alignment tools to identify conserved domains that might suggest functional similarities or differences between these proteins.

What are the typical storage and stability considerations for Recombinant Rhizobium sp. proteins?

Based on standard protocols for similar recombinant proteins, Recombinant Rhizobium sp. proteins typically require careful storage conditions to maintain their stability and bioactivity. Liquid formulations generally have a shelf life of approximately 6 months when stored at -20°C/-80°C, while lyophilized forms can remain stable for up to 12 months at the same temperatures . Repeated freeze-thaw cycles should be avoided to prevent protein degradation. For short-term use, working aliquots can be stored at 4°C for up to one week . When reconstituting lyophilized protein, it is recommended to use deionized sterile water to a concentration of 0.1-1.0 mg/mL after briefly centrifuging the vial to ensure all contents are at the bottom . The stability of the protein may also be influenced by buffer components, which should be optimized based on the specific experimental requirements and downstream applications.

How can proteomics approaches be used to elucidate the function of Uncharacterized Rhizobium proteins?

Proteomics approaches offer powerful tools for investigating the function of uncharacterized proteins like y4bA/y4pH (NGR_a00280). A comprehensive strategy would begin with high-resolution liquid chromatography-mass spectrometry (LC-MS/MS) to identify post-translational modifications and protein-protein interactions. Following the methodology employed in studies of Rhizobium-plant interactions, researchers should consider applying complete linkage and Euclidean distance methods for cluster analysis of protein intensities . Functional grouping can be accomplished using tools such as MapMan Mercator to categorize identified proteins into biological processes .

When working with uncharacterized Rhizobium proteins, comparative proteomics between wild-type and mutant strains lacking the protein of interest can reveal affected pathways. A previous study examining Rhizobium effects on plant seeds identified 213 proteins with significant differences between Rhizobium-treated and untreated samples, categorized into functional groups including TCA cycle, cell wall, plastid, development, and RNA processing . Similar approaches could help elucidate the function of y4bA/y4pH by identifying proteins with correlated expression patterns or physical interactions, suggesting functional relationships.

What experimental approaches are most effective for determining the biological activity of Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH?

Determining the biological activity of an uncharacterized protein requires a multi-faceted approach. For Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH, researchers should implement cell-based bioassays to measure potential biological activities. Standard bioassays include cell proliferation assays, chemotaxis assays, cytokine production assays, and cytotoxicity assays using appropriate indicator cells . The biological activity can be quantified as ED50 (effective dose 50), representing the concentration of the protein that induces 50% of the maximum response .

The specific activity can be calculated using the formula: 1 × 10^6 / ED50 (ng/mL) = specific activity (units/mg) . It is recommended to determine the ED50 in your specific functional assay system rather than relying solely on the Certificate of Analysis values. For Rhizobium proteins that may function in plant-microbe interactions, plant cell-based assays or symbiosis phenotype rescue experiments with Rhizobium mutants lacking the protein of interest could provide functional insights. Additionally, researchers should explore potential enzymatic activities through targeted substrate utilization assays, particularly focusing on pathways involved in nitrogen fixation and plant growth promotion.

How might the Uncharacterized protein y4bA/y4pH contribute to Rhizobium-legume symbiosis at the molecular level?

The contribution of Uncharacterized protein y4bA/y4pH to Rhizobium-legume symbiosis likely involves complex molecular interactions that remain to be fully elucidated. Based on research on Rhizobium-plant interactions, this protein may participate in one or more of the following molecular processes: signaling pathways critical for nodule formation, regulation of nitrogen fixation, modulation of plant immune responses, or enhancement of plant growth parameters .

Proteomic studies have demonstrated that Rhizobium symbiosis influences the abundance of proteins involved in redox regulation, protein regulation, carbon metabolism, and late embryogenesis abundant (LEA) proteins in plant seeds . The uncharacterized protein y4bA/y4pH might function within these pathways, potentially contributing to the observed effects of Rhizobium on increased seed biomass, improved seed filling, and enhanced resistance to pathogens . To investigate this hypothesis, researchers could employ gene knockout or silencing approaches followed by comparative phenotypic, metabolomic, and proteomic analyses similar to those conducted in previous studies examining Rhizobium effects on pea plants . Additionally, protein localization studies using fluorescent tags could help determine whether y4bA/y4pH localizes to the plant-bacteria interface within nodules or remains within the bacterial cells, providing further clues to its functional role.

What purification strategies are recommended for isolating high-quality Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH?

Purification of Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH requires a systematic approach to achieve high purity and yield. The purification strategy should begin with selecting an appropriate expression system; while yeast has been used successfully for related proteins , bacterial expression systems like E. coli may also be suitable depending on protein characteristics. Incorporating an affinity tag during cloning facilitates initial purification, with common options including His-tag, GST-tag, or MBP-tag.

A recommended purification workflow includes:

  • Affinity chromatography as the initial capture step

  • Intermediate purification using ion exchange chromatography to remove contaminants with different charge properties

  • Polishing step with size exclusion chromatography to achieve final purity

Quality assessment should target a purity level >85% as verified by SDS-PAGE , with additional validation via Western blotting using antibodies against the protein or affinity tag. For functional studies, it is crucial to verify that the recombinant protein maintains its native conformation and activity after purification. This can be assessed through circular dichroism spectroscopy for secondary structure analysis and relevant bioactivity assays. If the protein will be used for structural studies, additional considerations for buffer optimization to enhance stability and reduce aggregation become essential.

How can researchers effectively design experiments to investigate the potential role of Uncharacterized protein y4bA/y4pH in plant growth promotion?

Designing experiments to investigate the potential role of Uncharacterized protein y4bA/y4pH in plant growth promotion requires a comprehensive approach that integrates molecular, physiological, and field-based methodologies. A systematic experimental design should include the following components:

Table 1: Experimental Design Framework for Investigating y4bA/y4pH in Plant Growth Promotion

PhaseExperimental ApproachMeasurementsControls
1. Genetic ManipulationGenerate knockout mutants and overexpression strains of y4bA/y4pH in RhizobiumPCR verification, protein expression analysis by Western blotWild-type Rhizobium, empty vector transformants
2. In vitro Plant GrowthPlant inoculation with mutant/overexpression strains under controlled conditionsNodulation efficiency, root architecture, shoot growth, nitrogen fixation ratesUninoculated plants, wild-type Rhizobium inoculation
3. Molecular AnalysisTranscriptomics and proteomics of plant tissuesDifferential gene expression, protein abundance patterns, metabolic pathway analysisMock-treated plants, plants inoculated with control strains
4. Stress Response EvaluationExpose plants to pathogens or abiotic stressorsDisease severity, ROS production, stress-responsive gene expressionUntreated plants, plants with wild-type Rhizobium

Based on previous research on Rhizobium effects on plants, measurements should focus on key parameters influenced by Rhizobium symbiosis, including seed weight, protein content, and resistance to pathogens . The experimental design should account for plant cultivar specificity, as responses to Rhizobium inoculation may vary among plant varieties . Additionally, researchers should implement metabolomic and proteomic analyses following established protocols for investigating Rhizobium-plant interactions, focusing on changes in carbon metabolism, redox regulation, and development-related proteins such as LEA family proteins .

What analytical techniques are most appropriate for characterizing the structure-function relationship of Uncharacterized protein y4bA/y4pH?

Characterizing the structure-function relationship of Uncharacterized protein y4bA/y4pH requires an integrated analytical approach combining structural biology techniques with functional assays. The following analytical techniques are particularly valuable for this purpose:

  • X-ray Crystallography or Cryo-EM: These techniques provide high-resolution structural information, revealing the three-dimensional arrangement of the protein. For y4bA/y4pH, crystallization conditions would need to be optimized, potentially using crystallization screens designed for bacterial proteins. The resulting structure can identify potential active sites or binding pockets.

  • Nuclear Magnetic Resonance (NMR) Spectroscopy: For smaller domains of y4bA/y4pH, NMR can provide structural information in solution, capturing dynamic aspects that might be missed by crystallography. This is particularly valuable for identifying flexible regions that may be involved in protein-protein interactions.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): This technique can map protein dynamics and conformational changes upon ligand binding or environmental changes, helping identify functionally important regions of y4bA/y4pH.

  • Site-Directed Mutagenesis: Based on structural predictions, systematic mutation of conserved residues can identify amino acids critical for function. Each mutant should be tested in functional assays relevant to Rhizobium-plant interactions, such as nodulation efficiency tests or plant growth promotion assays .

  • Protein-Protein Interaction Studies: Techniques such as pull-down assays, yeast two-hybrid, or proximity labeling followed by mass spectrometry can identify protein partners, providing clues to the cellular pathways involving y4bA/y4pH.

Integration of these analytical approaches with functional data from plant-based studies will establish correlations between structural features and biological functions. For instance, if structural analysis reveals similarity to known signaling proteins, subsequent experiments could test the protein's role in symbiotic signaling pathways by examining its effects on nodulation factors or plant defense responses .

How can Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH be utilized in studies of plant-pathogen interactions?

Recombinant Rhizobium sp. Uncharacterized protein y4bA/y4pH presents significant potential as a tool for investigating plant-pathogen interactions, particularly in the context of enhanced plant resistance mediated by Rhizobium symbionts. Previous research has demonstrated that Rhizobium inoculation can decrease disease severity and reduce seed infection levels in plants challenged with pathogens such as Didymella pinodes . To utilize y4bA/y4pH in such studies, researchers should consider the following approach:

First, determine whether purified y4bA/y4pH can directly induce plant defense responses by applying the recombinant protein to plant tissues and measuring defense-related parameters such as reactive oxygen species production, callose deposition, and expression of pathogenesis-related genes. Compare these responses to those induced by whole Rhizobium cells or known defense elicitors.

Second, investigate whether y4bA/y4pH influences plant-pathogen interactions by pre-treating plants with the recombinant protein before pathogen challenge. Quantify disease progression, pathogen growth, and plant defense responses in treated versus untreated plants. This experimental design should include appropriate controls such as heat-denatured protein and unrelated recombinant proteins to confirm specificity of any observed effects.

Third, examine potential mechanisms of action by analyzing changes in plant proteome and metabolome following y4bA/y4pH treatment, focusing particularly on proteins involved in redox regulation, cell wall adjustments, and LEA proteins, which have been implicated in Rhizobium-mediated disease resistance . The experimental design should incorporate both compatible and incompatible plant-pathogen interactions to determine whether y4bA/y4pH influences basal or specific resistance mechanisms.

What are the key considerations for experimental design when studying the effects of Uncharacterized protein y4bA/y4pH on crop productivity?

When designing experiments to study the effects of Uncharacterized protein y4bA/y4pH on crop productivity, researchers must address several critical considerations to ensure meaningful and translatable results. First, experiments should progressively scale from controlled laboratory conditions to field settings, recognizing that environmental factors significantly influence the functioning of Rhizobium as a bio-control agent . This stepped approach allows for initial mechanism elucidation under controlled conditions before testing real-world applicability.

Table 2: Experimental Design Considerations for Crop Productivity Studies with y4bA/y4pH

Experimental LevelKey ConsiderationsMeasurementsLimitations to Address
Laboratory/Growth ChamberLight intensity, temperature, humidity control, sterile soil conditionsDetailed molecular and physiological parameters, precise biomass measurementsLimited scale, absence of natural microbial communities
GreenhouseSemi-controlled environment, larger plant populations, longer growth periodsYield components, disease incidence, nutrient contentStill lacks full field conditions, artificial soil composition
Field TrialsMultiple locations, seasons, soil types; realistic crop management practicesPractical yield metrics, economic parameters, ecosystem impactsHigh variability, multifactorial influences, need for multi-year studies

Critical to experimental design is the inclusion of appropriate controls, including: (1) untreated plants, (2) plants treated with wild-type Rhizobium, (3) plants treated with Rhizobium mutants lacking y4bA/y4pH, and (4) plants treated with Rhizobium overexpressing y4bA/y4pH. This approach allows for isolation of protein-specific effects from general Rhizobium benefits.

The selection of productivity metrics should be comprehensive, encompassing not only yield quantity but also quality parameters. Previous studies have demonstrated that Rhizobium symbiosis enhances seed yield, protein content, biomass of green plant parts, and seed quality . Therefore, measurements should include seed fresh and dry weights, protein content, germination rates, and seedling vigor. Additionally, researchers should analyze seed proteome and metabolome changes to connect molecular mechanisms to productivity outcomes .

How might comparative analyses of y4bA/y4pH with related proteins y4kH (NGR_a02880) inform functional predictions?

Comparative analyses between y4bA/y4pH (NGR_a00280) and related proteins such as y4kH (NGR_a02880) can provide valuable insights into their potential functions through evolutionary and structural relationships. An effective comparative analysis should incorporate multiple approaches:

First, conduct comprehensive sequence analysis using bioinformatics tools to identify conserved domains, motifs, and potential functional sites. Multiple sequence alignment of y4bA/y4pH, y4kH, and other related proteins across different Rhizobium species can reveal evolutionarily conserved regions that likely represent functionally important elements. The sequence of y4kH (MRERAVGSKG SFPIGIAELQ EVSCASVEIN QPLLLADLRS DGMLRMRIPT DAARAASHEL GKQWSRALWL HDEKPDGIIY DSRLNGEANT ALFDRALPKL NVKSSGPLLD FRDEVAQILD DFSLEIV) can serve as a reference point for identifying shared sequence features.

Third, analyze the genomic context of both genes within the Rhizobium genome. Proximity to genes of known function, shared regulatory elements, or inclusion in known operons can provide clues about functional relationships and biological pathways involving these proteins.

Fourth, examine differential expression patterns of both genes under various conditions, particularly during different stages of Rhizobium-legume symbiosis. Correlated expression patterns may suggest functional relationships or involvement in similar processes.

Fifth, perform targeted functional assays with both purified proteins to compare their biochemical activities, including potential enzymatic functions, binding partners, or effects on plant cells. Similar experimental outcomes would strengthen functional predictions for both proteins.

This multi-faceted comparative approach can generate testable hypotheses about the function of y4bA/y4pH based on any established or emerging understanding of y4kH, potentially accelerating functional characterization of both uncharacterized proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.