Recombinant Rhizobium sp. Uncharacterized protein y4cB (NGR_a00120)
Shipped with Ice Packs 
In Stock 
Description
Overview and Basic Characteristics
Recombinant Rhizobium sp. Uncharacterized Protein y4cB (NGR_a00120) is a recombinant protein with the following key attributes:
| Supplier | Product Code | Tag | Purity | Species |
|---|---|---|---|---|
| Creative BioMart | RFL6630SF | His | >90% | Sinorhizobium fredii |
| Cusabio | CSB-CF345465RKX | His | >90% | Rhizobium sp. (NGR234) |
Production and Expression Details
The protein is produced via recombinant technology with standardized protocols:
| Parameter | Detail |
|---|---|
| Host Organism | E. coli |
| Purification Method | SDS-PAGE validated (>90% purity) |
| Expression Region | Full-length (1–98 aa) |
Applications and Research Findings
While the protein remains uncharacterized, its transmembrane nature suggests potential roles in:
-
Membrane-Associated Functions: Transport, signaling, or interaction with host organisms (e.g., symbiosis in legumes).
-
Structural Studies: X-ray crystallography or NMR due to its full-length production.
No specific functional pathways or interacting proteins are documented in available literature .
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your demand.
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a00120; y4cB; Uncharacterized protein y4cB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a00120
Target Protein Sequence
MIVTLLNALSAMAAFTAAGLWWRSTVIAVPFDHEIPEDGWRPAAILASGPKGDIDVFKTQ
NAANALNNRAAKAAALAAACQGTAIALPILQDMFHALV
Uniprot No.
Target Background
Database Links
KEGG: rhi:NGR_a00120
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
