NGR_a03700 is encoded by the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234, a strain notable for its extensive secretion systems and ability to nodulate diverse legumes . Key identifiers include:
The protein belongs to the inositol monophosphatase superfamily and is predicted to localize to the cell membrane as a multi-pass transmembrane protein.
Produced in E. coli with an N-terminal His-tag, this version includes the complete 275-aa sequence:
Amino Acid Sequence
MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIH AQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALP ALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVC LGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQ HLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD
Structural studies
Antibody development
Functional assays (e.g., membrane protein interactions)
Partial versions are expressed in alternative hosts (yeast, baculovirus, mammalian cells) with varying tags:
| Host | Purity | Tag | Product Code |
|---|---|---|---|
| E. coli | >85% | Undisclosed | BT1572883 |
| Yeast | >85% | Undisclosed | BT1572883 |
| Baculovirus | >85% | Undisclosed | BT1572883 |
| Mammalian cells | >85% | Undisclosed | BT1572883 |
While y4fL remains uncharacterized, its genomic context provides indirect clues:
Symbiotic Plasmid Role: Encoded on pNGR234a, which contains genes for rhamnan synthesis (critical for lipopolysaccharide production and nodulation) .
Secretion Systems: NGR234 harbors six type I secretion systems and three type IV attachment systems, suggesting potential roles in host-microbe interactions .
Regulatory Pathways: Flavonoid-inducible regulatory networks control rhamnan O-antigen synthesis in NGR234, though y4fL’s involvement is unconfirmed .
Functional characterization (e.g., enzymatic activity, membrane topology).
Interaction mapping with symbiosis-related proteins.
Role in quorum sensing or signal transduction.
KEGG: rhi:NGR_a03700
Recombinant Rhizobium sp. Uncharacterized protein y4fL (NGR_a03700) is a full-length protein (275 amino acids) that originates from Sinorhizobium fredii. The protein is typically expressed in E. coli with an N-terminal His-tag for purification purposes. While classified as "uncharacterized," it belongs to a family of proteins found in Rhizobium species that are increasingly recognized for their roles in plant-bacterial symbiotic relationships. The complete amino acid sequence is: MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIHAQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALPALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVCLGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQHLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD .
While NGR_a03700 remains largely uncharacterized, it shares sequence similarities with other Y4 proteins found in Rhizobium sp. strain NGR234. For instance, Y4lO protein has been identified as a symbiotic determinant required for symbiosome differentiation in nitrogen-fixing nodules. Y4lO mitigates senescence-inducing effects in plant-rhizobium interactions, suggesting a potential functional relationship with other Y4 proteins like y4fL . The broader family of Y4 proteins appears to be involved in host-specific nodulation and symbiotic establishment processes that are critical for plant growth promotion and nitrogen fixation activities .
The recombinant protein is typically supplied as a lyophilized powder that requires specific handling for optimal stability and activity. The recommended protocol includes:
| Storage Parameter | Recommendation |
|---|---|
| Short-term storage | 4°C for up to one week (working aliquots) |
| Long-term storage | -20°C/-80°C, with aliquoting to avoid repeated freeze-thaw cycles |
| Storage buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Reconstitute in deionized sterile water to 0.1-1.0 mg/mL; add glycerol (typically 50% final concentration) for long-term storage |
Before opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom. Repeated freeze-thaw cycles should be strictly avoided as they can severely compromise protein integrity and activity .
Several expression systems can be used to produce Recombinant Rhizobium sp. Uncharacterized protein y4fL, each with specific advantages:
| Expression System | Advantages | Disadvantages | Recommended Use Case |
|---|---|---|---|
| E. coli | High yields, shorter production time, cost-effective | Limited post-translational modifications | Basic structural studies, antibody production |
| Yeast | Good yields, some post-translational modifications | More complex than E. coli | Functional studies requiring moderate modifications |
| Insect cells (baculovirus) | Complex post-translational modifications | Longer production time, higher cost | Studies requiring proper protein folding |
| Mammalian cells | Native-like post-translational modifications | Lowest yields, highest cost, longest production time | Studies requiring authentic activity |
E. coli and yeast systems generally offer the best compromise between yield and production time for initial characterization studies. For more complex functional assays where post-translational modifications might be critical, insect or mammalian cell expression systems are recommended despite their higher cost and complexity .
Designing experiments for an uncharacterized protein like y4fL requires a systematic approach:
Sequence analysis and homology modeling:
Perform bioinformatic analysis to identify conserved domains and motifs
Conduct phylogenetic analysis to identify closely related characterized proteins
Use tools like AlphaFold2 for structural prediction
Expression system selection:
Select an appropriate system based on experimental goals (as detailed in FAQ 2.2)
Consider adding different tags (His, GST, etc.) to facilitate purification and detection
Functional assessment through hypothesis-driven experiments:
Design experiments based on the protein's genomic context in Rhizobium
Consider protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid)
Test for enzymatic activities suggested by sequence similarities
Evaluate role in plant-bacterial interactions through knockout/complementation studies
Controls and validation:
Include appropriate positive and negative controls
Validate findings with complementary approaches
Consider site-directed mutagenesis of predicted functional residues
This stepwise approach follows the general experimental design principles of formulating clear hypotheses, designing treatments to test independent variables, and planning appropriate measurements of dependent variables .
For studying protein-protein interactions of y4fL, consider implementing these methodological approaches:
In vitro interaction methods:
Pull-down assays using His-tagged y4fL as bait
Surface Plasmon Resonance (SPR) for interaction kinetics
Isothermal Titration Calorimetry (ITC) for thermodynamic parameters
In vivo interaction methods:
Co-immunoprecipitation from Rhizobium or heterologous systems
Yeast two-hybrid screening against Rhizobium or plant protein libraries
Proximity-dependent biotin labeling (BioID or TurboID)
Fluorescence Resonance Energy Transfer (FRET) for spatial interactions
Structural approaches:
X-ray crystallography of protein complexes
Cryo-electron microscopy for larger complexes
Hydrogen-deuterium exchange mass spectrometry for interaction interfaces
When designing these experiments, use the two-way co-immunoprecipitation approach similar to what was successful for studying the interaction between NME1 and DNM2 proteins in other systems . This approach can provide strong evidence for direct protein-protein interactions by demonstrating reciprocal binding.
To investigate y4fL's role in symbiosome formation and nitrogen fixation, a multi-faceted approach is recommended:
Generate knockout and complementation strains:
Create a clean y4fL deletion in Rhizobium sp. strain NGR234
Develop complementation strains with wild-type and mutated versions
Create double mutants with other symbiosis-related genes (e.g., nopL, y4lO)
Plant nodulation assays:
Microscopic analysis:
Use electron microscopy to analyze symbiosome development
Employ fluorescently-tagged variants for in vivo tracking
Quantify bacteroid differentiation and persistence
Transcriptomic and metabolomic analyses:
Compare gene expression profiles between wild-type and mutant strains
Analyze metabolite changes in nodules formed by different strains
Identify pathways affected by y4fL mutation
This approach parallels successful studies of related proteins like Y4lO, which was shown to be essential for proper symbiosome differentiation. In those studies, mutation of y4lO led to abnormal infection droplet formation and premature nodule senescence in certain host plants .
To determine if y4fL functions as a T3SS effector, implement these specialized methodologies:
Secretion assays:
Create reporter fusion constructs (e.g., y4fL-adenylate cyclase)
Test secretion in wild-type Rhizobium and T3SS mutants
Use Western blotting to detect secreted protein in culture supernatants
Promoter analysis:
Translocation assays:
Use split-GFP or other reporter systems to detect translocation into plant cells
Perform immunolocalization studies in infected plant tissues
Test for plant cellular responses typically triggered by T3SS effectors
Functional characterization:
This methodological framework is based on successful approaches used to characterize Y4lO as a T3SS effector that influences symbiotic outcomes in a host-specific manner .
Working with uncharacterized proteins presents several analytical challenges:
Lack of functional reference points:
Solution: Use phylogenetic profiling to identify co-occurring genes
Implement guilt-by-association approaches using genomic context
Compare across multiple Rhizobium species to identify conserved patterns
Complex phenotypic readouts:
Solution: Design clear quantitative measurements
Use multivariate statistical approaches to analyze complex data
Establish robust controls with known phenotypic outcomes
Distinguishing direct vs. indirect effects:
Solution: Use time-course experiments to establish causality
Implement genetic suppressor/enhancer screens
Use conditional expression systems to control timing of protein production
Reproducibility challenges:
Solution: Standardize protein preparation methods
Validate key findings using multiple experimental approaches
Document all experimental conditions thoroughly, including protein batch information
For data interpretation, focus on placing findings in the context of known Rhizobium symbiotic mechanisms and plant growth promotion activities, as these provide the most likely functional context for y4fL based on genomic positioning and homology to other Y4 proteins .
Differentiating specific from non-specific effects requires rigorous experimental design:
Use multiple controls:
Include buffer-only controls
Use irrelevant proteins expressed and purified under identical conditions
Use heat-denatured y4fL protein to control for structural specificity
Include mutated versions of y4fL with alterations in predicted functional domains
Implement dose-response studies:
Test multiple concentrations to establish dose-dependent relationships
Look for saturation effects that suggest specific binding or activity
Plot EC50/IC50 values to compare with known specific interactions
Competition assays:
Use unlabeled y4fL to compete with labeled protein in binding assays
Test if specific molecular interactions can be outcompeted
Compare competition profiles with non-specific competitors
Kinetic analysis:
Measure on/off rates for molecular interactions
Compare with known specific and non-specific interactions
Look for characteristic kinetic signatures of specific binding
These approaches follow established principles in protein biochemistry for distinguishing specific from non-specific effects and can help validate the biological relevance of observed activities .
To investigate y4fL's potential role in plant growth promotion or drought tolerance, design experiments that isolate its contribution:
Genetic approach:
Create y4fL deletion mutants in Rhizobium sp.
Develop strains overexpressing y4fL
Create point mutations in conserved residues to identify functional domains
Plant growth assays under normal conditions:
Inoculate plants with wild-type, mutant, and complemented strains
Measure multiple growth parameters (root/shoot length, biomass, etc.)
Analyze nutrient uptake and photosynthetic efficiency
Drought stress experiments:
Implement controlled drought conditions (water withholding or PEG treatment)
Measure physiological parameters (relative water content, stomatal conductance)
Assess survival rates and recovery after rehydration
Molecular analysis:
Analyze expression of plant stress-response genes
Measure production of osmoprotectants and antioxidants
Examine root architecture changes in response to inoculation
This experimental framework is based on successful approaches used to characterize other Rhizobium strains with plant growth promoting and drought tolerance properties , where specific genes like exoX, htrA, Nif, nodA, eptA, and IAA were implicated in these beneficial effects.
To investigate potential synergistic interactions between y4fL and other symbiotic factors, employ these methodologies:
Multiple gene mutation studies:
Create single, double, and multiple mutants lacking y4fL and other symbiotic genes
Test these in plant nodulation and nitrogen fixation assays
Look for synergistic or epistatic relationships between mutations
Co-expression analysis:
Analyze the co-expression of y4fL with other symbiotic genes under various conditions
Identify potential regulatory networks using RNA-Seq data
Test for co-regulation by shared transcription factors
Protein-protein interaction network mapping:
Use pull-down assays or co-immunoprecipitation to identify interaction partners
Construct comprehensive interaction networks using mass spectrometry
Validate key interactions using targeted approaches
Functional complementation assays:
Test if expression of other symbiotic determinants can rescue y4fL mutant phenotypes
Examine if y4fL overexpression can compensate for deficiencies in other pathways
Create chimeric proteins to identify functional domains
This approach is supported by research on Y4lO, which showed synergistic interactions with the T3 effector NopL in nitrogen-fixing nodules. In those studies, Y4lO mitigated the senescence-inducing effects caused by NopL, demonstrating complex interactions between symbiotic determinants .
For determining the three-dimensional structure of y4fL, consider these contemporary approaches:
X-ray crystallography:
Optimize protein expression and purification for high purity (>95%)
Screen multiple crystallization conditions
Consider co-crystallization with potential binding partners
Use molecular replacement with homologous structures if available
Cryo-electron microscopy (Cryo-EM):
Particularly useful if y4fL forms larger complexes
Can provide structural insights even without crystallization
Allows visualization of different conformational states
Nuclear Magnetic Resonance (NMR) spectroscopy:
Suitable for determining solution structure
Requires isotope labeling (15N, 13C) of the recombinant protein
Provides dynamic information not accessible by static methods
Computational approaches:
Leverage AlphaFold2 or RoseTTAFold for initial structure prediction
Validate predictions with experimental data (CD spectroscopy, limited proteolysis)
Use molecular dynamics simulations to study conformational flexibility
Hybrid methods:
Combine low-resolution data from small-angle X-ray scattering (SAXS) with computational modeling
Use cross-linking mass spectrometry to obtain distance constraints
Integrate multiple data sources for comprehensive structural models
These approaches follow current best practices in structural biology, including the increasing use of AI-based prediction tools to complement experimental methods .
To investigate potential enzymatic activities of y4fL based on sequence similarities:
Comprehensive sequence analysis:
Perform detailed sequence alignments with characterized enzymes
Identify conserved catalytic residues and substrate-binding motifs
Use tools like PROSITE, InterPro, and Pfam to identify functional domains
Activity screening assays:
Design a panel of enzyme assays based on predicted functions
Test purified recombinant y4fL against various substrates
Include positive controls with known enzymatic activities
Site-directed mutagenesis:
Mutate predicted catalytic residues to confirm their importance
Create chimeric proteins with domains from characterized enzymes
Test the effect of mutations on activity, substrate specificity, and kinetics
Structural studies focused on active sites:
Use ligand docking to predict substrate binding
Perform co-crystallization with substrates, products, or inhibitors
Employ hydrogen-deuterium exchange mass spectrometry to identify substrate-binding regions
In vivo validation:
Test if y4fL can complement known enzyme deficiencies in model organisms
Assess phenotypic changes when potential substrates are supplemented
Monitor metabolite changes upon y4fL expression or deletion
This methodological framework is supported by studies of related proteins like Y4lO, which showed sequence similarities to YopJ family effectors but demonstrated different substrate specificities when tested against potential targets .