Recombinant Rhizobium sp. Uncharacterized protein y4fL (NGR_a03700)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Genomic Context

NGR_a03700 is encoded by the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234, a strain notable for its extensive secretion systems and ability to nodulate diverse legumes . Key identifiers include:

AttributeDetail
Gene NameNGR_a03700
Synonymsy4fL; Uncharacterized protein y4fL
UniProt IDP55450
SpeciesSinorhizobium fredii (strain NGR234)
Genomic LocationpNGR234a (symbiotic plasmid)
Protein LengthFull-length: 275 amino acids (aa)

The protein belongs to the inositol monophosphatase superfamily and is predicted to localize to the cell membrane as a multi-pass transmembrane protein.

Full-Length Recombinant y4fL (NGR_a03700)

Produced in E. coli with an N-terminal His-tag, this version includes the complete 275-aa sequence:
Amino Acid Sequence
MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIH AQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALP ALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVC LGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQ HLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD

ParameterValue
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for storage

Key Applications:

  • Structural studies

  • Antibody development

  • Functional assays (e.g., membrane protein interactions)

Partial Recombinant y4fL (NGR_a03700)

Partial versions are expressed in alternative hosts (yeast, baculovirus, mammalian cells) with varying tags:

HostPurityTagProduct Code
E. coli>85%UndisclosedBT1572883
Yeast>85%UndisclosedBT1572883
Baculovirus>85%UndisclosedBT1572883
Mammalian cells>85%UndisclosedBT1572883

Functional Insights and Research Gaps

While y4fL remains uncharacterized, its genomic context provides indirect clues:

  • Symbiotic Plasmid Role: Encoded on pNGR234a, which contains genes for rhamnan synthesis (critical for lipopolysaccharide production and nodulation) .

  • Secretion Systems: NGR234 harbors six type I secretion systems and three type IV attachment systems, suggesting potential roles in host-microbe interactions .

  • Regulatory Pathways: Flavonoid-inducible regulatory networks control rhamnan O-antigen synthesis in NGR234, though y4fL’s involvement is unconfirmed .

Critical Research Needs:

  1. Functional characterization (e.g., enzymatic activity, membrane topology).

  2. Interaction mapping with symbiosis-related proteins.

  3. Role in quorum sensing or signal transduction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NGR_a03700; y4fL; Uncharacterized protein y4fL
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03700
Target Protein Sequence
MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIH AQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALP ALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVC LGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQ HLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD
Uniprot No.

Target Background

Database Links
Protein Families
Inositol monophosphatase superfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic information about Recombinant Rhizobium sp. Uncharacterized protein y4fL (NGR_a03700)?

Recombinant Rhizobium sp. Uncharacterized protein y4fL (NGR_a03700) is a full-length protein (275 amino acids) that originates from Sinorhizobium fredii. The protein is typically expressed in E. coli with an N-terminal His-tag for purification purposes. While classified as "uncharacterized," it belongs to a family of proteins found in Rhizobium species that are increasingly recognized for their roles in plant-bacterial symbiotic relationships. The complete amino acid sequence is: MTSDLDTRLDLLRNITSKVGAFALARFGNLSHIVIETKGEADYVSAADRDAESLARRLIHAQFPADAIVGEEQLGDAEVDHWLIDPIDGTANFLSGIPLWAVSIAFVRNKEPVLGAVALPALDTLLWASVDGPLHGTGSVSPLVGAQPIAFGIGRNRTWPLAHRLEVEAAFEARGYHIVCLGSCAAALAMVAAGRLAGYVEHGTHLWDCAAGHVLCRAAGAPSSILFEADGKVAIIAAPQHLRVTAKADARSLSEKHIFDPGSDRISHRMESSAD .

How is this protein related to other characterized proteins in Rhizobium species?

While NGR_a03700 remains largely uncharacterized, it shares sequence similarities with other Y4 proteins found in Rhizobium sp. strain NGR234. For instance, Y4lO protein has been identified as a symbiotic determinant required for symbiosome differentiation in nitrogen-fixing nodules. Y4lO mitigates senescence-inducing effects in plant-rhizobium interactions, suggesting a potential functional relationship with other Y4 proteins like y4fL . The broader family of Y4 proteins appears to be involved in host-specific nodulation and symbiotic establishment processes that are critical for plant growth promotion and nitrogen fixation activities .

What are the optimal storage and handling conditions for this recombinant protein?

The recombinant protein is typically supplied as a lyophilized powder that requires specific handling for optimal stability and activity. The recommended protocol includes:

Storage ParameterRecommendation
Short-term storage4°C for up to one week (working aliquots)
Long-term storage-20°C/-80°C, with aliquoting to avoid repeated freeze-thaw cycles
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to 0.1-1.0 mg/mL; add glycerol (typically 50% final concentration) for long-term storage

Before opening, it is recommended to briefly centrifuge the vial to bring the contents to the bottom. Repeated freeze-thaw cycles should be strictly avoided as they can severely compromise protein integrity and activity .

What expression systems are most suitable for producing this protein, and what are their comparative advantages?

Several expression systems can be used to produce Recombinant Rhizobium sp. Uncharacterized protein y4fL, each with specific advantages:

Expression SystemAdvantagesDisadvantagesRecommended Use Case
E. coliHigh yields, shorter production time, cost-effectiveLimited post-translational modificationsBasic structural studies, antibody production
YeastGood yields, some post-translational modificationsMore complex than E. coliFunctional studies requiring moderate modifications
Insect cells (baculovirus)Complex post-translational modificationsLonger production time, higher costStudies requiring proper protein folding
Mammalian cellsNative-like post-translational modificationsLowest yields, highest cost, longest production timeStudies requiring authentic activity

E. coli and yeast systems generally offer the best compromise between yield and production time for initial characterization studies. For more complex functional assays where post-translational modifications might be critical, insect or mammalian cell expression systems are recommended despite their higher cost and complexity .

How should I design experiments to characterize the function of this uncharacterized protein?

Designing experiments for an uncharacterized protein like y4fL requires a systematic approach:

  • Sequence analysis and homology modeling:

    • Perform bioinformatic analysis to identify conserved domains and motifs

    • Conduct phylogenetic analysis to identify closely related characterized proteins

    • Use tools like AlphaFold2 for structural prediction

  • Expression system selection:

    • Select an appropriate system based on experimental goals (as detailed in FAQ 2.2)

    • Consider adding different tags (His, GST, etc.) to facilitate purification and detection

  • Functional assessment through hypothesis-driven experiments:

    • Design experiments based on the protein's genomic context in Rhizobium

    • Consider protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid)

    • Test for enzymatic activities suggested by sequence similarities

    • Evaluate role in plant-bacterial interactions through knockout/complementation studies

  • Controls and validation:

    • Include appropriate positive and negative controls

    • Validate findings with complementary approaches

    • Consider site-directed mutagenesis of predicted functional residues

This stepwise approach follows the general experimental design principles of formulating clear hypotheses, designing treatments to test independent variables, and planning appropriate measurements of dependent variables .

What are the recommended approaches for studying protein-protein interactions involving this uncharacterized protein?

For studying protein-protein interactions of y4fL, consider implementing these methodological approaches:

  • In vitro interaction methods:

    • Pull-down assays using His-tagged y4fL as bait

    • Surface Plasmon Resonance (SPR) for interaction kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

  • In vivo interaction methods:

    • Co-immunoprecipitation from Rhizobium or heterologous systems

    • Yeast two-hybrid screening against Rhizobium or plant protein libraries

    • Proximity-dependent biotin labeling (BioID or TurboID)

    • Fluorescence Resonance Energy Transfer (FRET) for spatial interactions

  • Structural approaches:

    • X-ray crystallography of protein complexes

    • Cryo-electron microscopy for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry for interaction interfaces

When designing these experiments, use the two-way co-immunoprecipitation approach similar to what was successful for studying the interaction between NME1 and DNM2 proteins in other systems . This approach can provide strong evidence for direct protein-protein interactions by demonstrating reciprocal binding.

How can I investigate the potential role of y4fL in symbiosome formation and nitrogen fixation?

To investigate y4fL's role in symbiosome formation and nitrogen fixation, a multi-faceted approach is recommended:

  • Generate knockout and complementation strains:

    • Create a clean y4fL deletion in Rhizobium sp. strain NGR234

    • Develop complementation strains with wild-type and mutated versions

    • Create double mutants with other symbiosis-related genes (e.g., nopL, y4lO)

  • Plant nodulation assays:

    • Test the impact of y4fL mutation on various legume hosts

    • Examine nodule formation, nitrogen fixation capacity, and nodule ultrastructure

    • Compare with known symbiotic determinants like y4lO

  • Microscopic analysis:

    • Use electron microscopy to analyze symbiosome development

    • Employ fluorescently-tagged variants for in vivo tracking

    • Quantify bacteroid differentiation and persistence

  • Transcriptomic and metabolomic analyses:

    • Compare gene expression profiles between wild-type and mutant strains

    • Analyze metabolite changes in nodules formed by different strains

    • Identify pathways affected by y4fL mutation

This approach parallels successful studies of related proteins like Y4lO, which was shown to be essential for proper symbiosome differentiation. In those studies, mutation of y4lO led to abnormal infection droplet formation and premature nodule senescence in certain host plants .

What methodologies are appropriate for testing if y4fL functions as a Type 3 Secretion System (T3SS) effector protein?

To determine if y4fL functions as a T3SS effector, implement these specialized methodologies:

  • Secretion assays:

    • Create reporter fusion constructs (e.g., y4fL-adenylate cyclase)

    • Test secretion in wild-type Rhizobium and T3SS mutants

    • Use Western blotting to detect secreted protein in culture supernatants

  • Promoter analysis:

    • Analyze the promoter region for tts boxes (binding sites for TtsI)

    • Perform reporter gene assays to test promoter activity under T3SS-inducing conditions

    • Test dependency on the transcriptional activator TtsI

  • Translocation assays:

    • Use split-GFP or other reporter systems to detect translocation into plant cells

    • Perform immunolocalization studies in infected plant tissues

    • Test for plant cellular responses typically triggered by T3SS effectors

  • Functional characterization:

    • Express y4fL in plant cells to observe phenotypic changes

    • Test for suppression or induction of plant defense responses

    • Investigate enzymatic activities (e.g., acetyltransferase activity) similar to YopJ family effectors

This methodological framework is based on successful approaches used to characterize Y4lO as a T3SS effector that influences symbiotic outcomes in a host-specific manner .

What are the common challenges in analyzing experimental data from uncharacterized proteins, and how can they be addressed?

Working with uncharacterized proteins presents several analytical challenges:

  • Lack of functional reference points:

    • Solution: Use phylogenetic profiling to identify co-occurring genes

    • Implement guilt-by-association approaches using genomic context

    • Compare across multiple Rhizobium species to identify conserved patterns

  • Complex phenotypic readouts:

    • Solution: Design clear quantitative measurements

    • Use multivariate statistical approaches to analyze complex data

    • Establish robust controls with known phenotypic outcomes

  • Distinguishing direct vs. indirect effects:

    • Solution: Use time-course experiments to establish causality

    • Implement genetic suppressor/enhancer screens

    • Use conditional expression systems to control timing of protein production

  • Reproducibility challenges:

    • Solution: Standardize protein preparation methods

    • Validate key findings using multiple experimental approaches

    • Document all experimental conditions thoroughly, including protein batch information

For data interpretation, focus on placing findings in the context of known Rhizobium symbiotic mechanisms and plant growth promotion activities, as these provide the most likely functional context for y4fL based on genomic positioning and homology to other Y4 proteins .

How can I differentiate between specific and non-specific effects when introducing recombinant y4fL protein into experimental systems?

Differentiating specific from non-specific effects requires rigorous experimental design:

  • Use multiple controls:

    • Include buffer-only controls

    • Use irrelevant proteins expressed and purified under identical conditions

    • Use heat-denatured y4fL protein to control for structural specificity

    • Include mutated versions of y4fL with alterations in predicted functional domains

  • Implement dose-response studies:

    • Test multiple concentrations to establish dose-dependent relationships

    • Look for saturation effects that suggest specific binding or activity

    • Plot EC50/IC50 values to compare with known specific interactions

  • Competition assays:

    • Use unlabeled y4fL to compete with labeled protein in binding assays

    • Test if specific molecular interactions can be outcompeted

    • Compare competition profiles with non-specific competitors

  • Kinetic analysis:

    • Measure on/off rates for molecular interactions

    • Compare with known specific and non-specific interactions

    • Look for characteristic kinetic signatures of specific binding

These approaches follow established principles in protein biochemistry for distinguishing specific from non-specific effects and can help validate the biological relevance of observed activities .

How can I design experiments to test if y4fL contributes to plant growth promotion or drought tolerance?

To investigate y4fL's potential role in plant growth promotion or drought tolerance, design experiments that isolate its contribution:

  • Genetic approach:

    • Create y4fL deletion mutants in Rhizobium sp.

    • Develop strains overexpressing y4fL

    • Create point mutations in conserved residues to identify functional domains

  • Plant growth assays under normal conditions:

    • Inoculate plants with wild-type, mutant, and complemented strains

    • Measure multiple growth parameters (root/shoot length, biomass, etc.)

    • Analyze nutrient uptake and photosynthetic efficiency

  • Drought stress experiments:

    • Implement controlled drought conditions (water withholding or PEG treatment)

    • Measure physiological parameters (relative water content, stomatal conductance)

    • Assess survival rates and recovery after rehydration

  • Molecular analysis:

    • Analyze expression of plant stress-response genes

    • Measure production of osmoprotectants and antioxidants

    • Examine root architecture changes in response to inoculation

This experimental framework is based on successful approaches used to characterize other Rhizobium strains with plant growth promoting and drought tolerance properties , where specific genes like exoX, htrA, Nif, nodA, eptA, and IAA were implicated in these beneficial effects.

What methods should I use to investigate potential synergistic interactions between y4fL and other symbiotic determinants?

To investigate potential synergistic interactions between y4fL and other symbiotic factors, employ these methodologies:

  • Multiple gene mutation studies:

    • Create single, double, and multiple mutants lacking y4fL and other symbiotic genes

    • Test these in plant nodulation and nitrogen fixation assays

    • Look for synergistic or epistatic relationships between mutations

  • Co-expression analysis:

    • Analyze the co-expression of y4fL with other symbiotic genes under various conditions

    • Identify potential regulatory networks using RNA-Seq data

    • Test for co-regulation by shared transcription factors

  • Protein-protein interaction network mapping:

    • Use pull-down assays or co-immunoprecipitation to identify interaction partners

    • Construct comprehensive interaction networks using mass spectrometry

    • Validate key interactions using targeted approaches

  • Functional complementation assays:

    • Test if expression of other symbiotic determinants can rescue y4fL mutant phenotypes

    • Examine if y4fL overexpression can compensate for deficiencies in other pathways

    • Create chimeric proteins to identify functional domains

This approach is supported by research on Y4lO, which showed synergistic interactions with the T3 effector NopL in nitrogen-fixing nodules. In those studies, Y4lO mitigated the senescence-inducing effects caused by NopL, demonstrating complex interactions between symbiotic determinants .

What experimental approaches can determine the three-dimensional structure of y4fL protein?

For determining the three-dimensional structure of y4fL, consider these contemporary approaches:

  • X-ray crystallography:

    • Optimize protein expression and purification for high purity (>95%)

    • Screen multiple crystallization conditions

    • Consider co-crystallization with potential binding partners

    • Use molecular replacement with homologous structures if available

  • Cryo-electron microscopy (Cryo-EM):

    • Particularly useful if y4fL forms larger complexes

    • Can provide structural insights even without crystallization

    • Allows visualization of different conformational states

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Suitable for determining solution structure

    • Requires isotope labeling (15N, 13C) of the recombinant protein

    • Provides dynamic information not accessible by static methods

  • Computational approaches:

    • Leverage AlphaFold2 or RoseTTAFold for initial structure prediction

    • Validate predictions with experimental data (CD spectroscopy, limited proteolysis)

    • Use molecular dynamics simulations to study conformational flexibility

  • Hybrid methods:

    • Combine low-resolution data from small-angle X-ray scattering (SAXS) with computational modeling

    • Use cross-linking mass spectrometry to obtain distance constraints

    • Integrate multiple data sources for comprehensive structural models

These approaches follow current best practices in structural biology, including the increasing use of AI-based prediction tools to complement experimental methods .

How can I investigate the potential enzymatic activity of y4fL based on sequence similarity to characterized proteins?

To investigate potential enzymatic activities of y4fL based on sequence similarities:

  • Comprehensive sequence analysis:

    • Perform detailed sequence alignments with characterized enzymes

    • Identify conserved catalytic residues and substrate-binding motifs

    • Use tools like PROSITE, InterPro, and Pfam to identify functional domains

  • Activity screening assays:

    • Design a panel of enzyme assays based on predicted functions

    • Test purified recombinant y4fL against various substrates

    • Include positive controls with known enzymatic activities

  • Site-directed mutagenesis:

    • Mutate predicted catalytic residues to confirm their importance

    • Create chimeric proteins with domains from characterized enzymes

    • Test the effect of mutations on activity, substrate specificity, and kinetics

  • Structural studies focused on active sites:

    • Use ligand docking to predict substrate binding

    • Perform co-crystallization with substrates, products, or inhibitors

    • Employ hydrogen-deuterium exchange mass spectrometry to identify substrate-binding regions

  • In vivo validation:

    • Test if y4fL can complement known enzyme deficiencies in model organisms

    • Assess phenotypic changes when potential substrates are supplemented

    • Monitor metabolite changes upon y4fL expression or deletion

This methodological framework is supported by studies of related proteins like Y4lO, which showed sequence similarities to YopJ family effectors but demonstrated different substrate specificities when tested against potential targets .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.