Recombinant Rhizobium sp. Uncharacterized protein y4jE (NGR_a03110)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Rhizobium sp. Uncharacterized protein y4jE (NGR_a03110) is a protein derived from Rhizobium sp. NGR234 . The protein's function is currently unknown, hence the term "uncharacterized" .

Source and Production

Recombinant y4jE is produced using an in vitro E. coli expression system .

Sequence Information

The protein is associated with the UniProt number P55507 .

Form and Purity

The protein is available in both liquid and lyophilized forms . It has a purity level of >85% as determined by SDS-PAGE .

Reconstitution

If the protein is in lyophilized form, it should be briefly centrifuged before opening the vial . Reconstitution should be done using deionized sterile water to a concentration of 0.1-1.0 mg/mL . The addition of glycerol to a final concentration of 5-50% is recommended for long-term storage at -20°C/-80°C .

Role of Rhizobium sp. NGR234

Rhizobium sp. strain NGR234 is an alphaproteobacterium known for forming nitrogen-fixing nodules with a wide range of legumes . Its genome encodes numerous secretion systems and genes linked to the metabolism of diverse compounds, enabling it to adapt to various environmental conditions .

Research on Secretion Systems in Rhizobium sp. NGR234

Rhizobium sp. NGR234 possesses a remarkable number of secretion systems, including general and export pathways, a twin arginine translocase secretion system, type I, III, and IV systems . Effector proteins like NopL, secreted via these systems, can modulate plant defense responses .

NopD and SUMO Protease Activity

Research has shown that NopD, another protein from Rhizobium, exhibits SUMO protease activity, indicating its role in processing SUMO proteins and desumoylating SUMO-conjugated proteins .

Proteome Analysis of Rhizobium

Proteome analysis has been employed to study Rhizobium proteins, revealing differentially displayed proteins in response to flavonoids and identifying various nodulation gene products .

Diagnostic Proteins in Rhizobium Species

Studies have identified diagnostic proteins in different Rhizobium species, aiding in their classification and understanding of their unique characteristics .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To prioritize a specific tag, please inform us during your order; we will accommodate your request whenever possible.
Synonyms
NGR_a03110; y4jE; Uncharacterized protein y4jE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-273
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03110
Target Protein Sequence
MTRPAVSYDELDEYLRGDGHNDYVGVSAIDGLIAAVVAGPVTILPDIWLPHVFGGSMPQA RPGSIEERLVNTVLNRHDEVESLLRDAPGHYYPIFMNHKGKTIVGPWAIGFSLGLSLGGE AWAPIAGNAKASDLPHHGRQSAAGQTAHPAFSSGAAEIESNRSSSHHIRSPAVARHHKTG PITTQPPAQTQPYRKTACSLRLQCTRSVEHDTQARGGPCIPGVSGLKLGLRPADRWSGCR WEHVVAYLGSPLYESTSTCAEGADRQLLVLRED
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does y4jE relate to other proteins in Rhizobium species?

Y4jE belongs to a class of proteins found in Rhizobia that may be involved in plant-microbe interactions. While its specific function remains undetermined, it shares the characteristic features of proteins from Rhizobium species, which are well-studied for their role in nitrogen fixation and symbiotic relationships with leguminous plants .

Rhizobia species contain various proteins classified based on their physiological, morphological, and biochemical properties. Historically, these bacteria were classified into seven cross-inoculation groups including Sinorhizobium meliloti (alfalfa group), Rhizobium trifolii (clover group), and others . The y4jE protein specifically comes from Sinorhizobium fredii (also referred to as Rhizobium sp. strain NGR234), placing it in the evolutionary context of nitrogen-fixing soil bacteria .

What expression systems are recommended for recombinant production of y4jE protein?

The optimal expression system for y4jE protein is E. coli, as evidenced by successful recombinant production documented in commercial preparations . For research purposes, the following methodological approach is recommended:

  • Vector Selection: Binary vectors such as pPZP211 (10.1 Kb), pSoup (9.3 Kb), or pART27 (10.9 Kb) have been shown to effectively transform Rhizobium-related proteins with varying efficiencies (pPZP211: 160 × 10³ CFU/μg DNA; pSoup: 5.3 × 10³ CFU/μg DNA; pART27: 61 × 10³ CFU/μg DNA) .

  • Tag Selection: N-terminal His-tagging has been successfully employed for purification purposes . The inclusion of a histidine tag facilitates protein purification through nickel affinity chromatography while minimizing interference with protein function.

  • Expression Conditions:

    • Induction with IPTG (0.1-1.0 mM) when cultures reach OD₆₀₀ of 0.6-0.8

    • Post-induction growth at 16-25°C for 16-20 hours to enhance protein solubility

    • Use of rich media supplemented with appropriate antibiotics based on vector selection

  • Cell Lysis: Sonication or high-pressure homogenization in Tris-based buffers (typically 20-50 mM Tris-HCl, pH 8.0, 150-300 mM NaCl) with protease inhibitors.

What purification strategies yield the highest purity for y4jE protein research?

Based on the available information about recombinant y4jE production, a multi-step purification strategy is recommended:

  • Initial Capture: His-tagged y4jE protein can be purified using immobilized metal affinity chromatography (IMAC) with Ni-NTA or similar matrices .

  • Secondary Purification: Size exclusion chromatography to remove aggregates and contaminants of different molecular weights.

  • Quality Control: SDS-PAGE analysis to confirm purity (target >90% as indicated for commercial preparations) .

  • Storage Buffer Optimization: The recommended storage buffer contains Tris-based components with 50% glycerol for long-term stability . For lyophilized preparations, a Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been validated .

  • Purity Verification: Greater than 90% purity should be achieved as determined by SDS-PAGE analysis before proceeding with functional studies .

What bioinformatic approaches are most informative for predicting the function of uncharacterized proteins like y4jE?

For uncharacterized proteins like y4jE, a comprehensive bioinformatic analysis pipeline should include:

  • Sequence-Based Analysis:

    • Homology searches using BLAST against multiple databases (UniProt, PDB, COG)

    • Multiple sequence alignment with related proteins

    • Identification of conserved domains using InterPro, PFAM, or SMART

    • Prediction of transmembrane regions, signal peptides, and subcellular localization

  • Structure Prediction:

    • Secondary structure prediction using PSIPRED or JPred

    • Tertiary structure modeling using AlphaFold2 or I-TASSER

    • Identification of potential binding sites or catalytic residues

  • Functional Inference:

    • Gene neighborhood analysis to identify functionally related genes

    • Co-expression data analysis if available

    • Phylogenetic profiling to determine evolutionary conservation patterns

  • Integration with Experimental Data:

    • Correlation with available proteomics or transcriptomics data from Rhizobium studies

    • Mapping of known protein-protein interactions in related proteins

This comprehensive approach provides multiple lines of evidence that can be used to formulate testable hypotheses about y4jE function.

How can researchers experimentally investigate the potential role of y4jE in plant-microbe interactions?

To investigate y4jE's potential role in plant-microbe interactions, researchers should consider a multi-faceted experimental design:

  • Gene Knockout/Knockdown Studies:

    • Generate y4jE deletion mutants in Rhizobium sp.

    • Compare nodulation efficiency, nitrogen fixation rates, and plant growth promotion between wild-type and mutant strains

    • Complementation studies to confirm phenotype is specifically due to y4jE loss

  • Localization Studies:

    • Create fluorescent protein fusions (GFP-y4jE) to track protein localization during symbiosis

    • Immunolocalization using antibodies against recombinant y4jE

    • Fractionation studies to determine subcellular localization

  • Interaction Studies:

    • Yeast two-hybrid or pull-down assays to identify protein interaction partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid systems specifically adapted for Rhizobium proteins

  • Gene Expression Analysis:

    • RT-qPCR to monitor y4jE expression during different stages of nodulation

    • RNA-seq to identify co-regulated genes during symbiosis

    • Promoter-reporter fusions to visualize expression patterns in planta

  • Host Plant Response:

    • Transcriptomic analysis of plant genes affected by wild-type vs. y4jE mutant Rhizobium

    • Metabolomic profiling to identify biochemical changes

    • Microscopic analysis of infection thread formation and nodule development

How might y4jE be utilized in plant genetic engineering applications?

The potential application of y4jE in plant genetic engineering requires consideration of Rhizobium's unique capabilities in plant transformation:

  • Vector Construction for Plant Transformation:

    • Incorporate y4jE into binary vectors similar to those used with Agrobacterium-mediated transformation

    • Design expression cassettes with appropriate plant promoters and terminators

    • Include selectable markers compatible with plant selection systems

  • Transformation Protocol Development:

    • Modified leaf disk method: Pre-treat leaf disks with acetosyringone (100-200 μM) to induce virulence genes

    • Co-cultivation of plant tissue with Rhizobium carrying y4jE constructs for 2-3 days

    • Transfer to selection media containing appropriate antibiotics

  • Verification of Transformation:

    • PCR and Southern blot analysis to confirm integration

    • RT-PCR and Western blot to verify expression

    • Phenotypic analysis based on the predicted function of y4jE

  • Comparative Analysis with Agrobacterium:

    • Transformation efficiency measurements show Sinorhizobium meliloti achieves approximately 25% of Agrobacterium's efficiency, while Mesorhizobium loti achieves about one-third of S. meliloti's efficiency

    • Optimization of protocols specifically for Rhizobium-mediated transformation

  • Environmental and Safety Considerations:

    • Rhizobia display minimal survival in groundwater and sewage, with limited dispersal through soil and water, potentially making them safer tools for environmental applications compared to Agrobacterium

    • Reduced need for protective measures during field tests compared to some agricultural agents

What advanced analytical techniques can resolve contradictory data about y4jE function?

When faced with contradictory data regarding y4jE function, researchers should employ the following advanced analytical approaches:

  • Structural Biology Techniques:

    • X-ray crystallography or cryo-EM to determine precise 3D structure

    • NMR studies to examine dynamic interactions with potential binding partners

    • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon binding

  • Systems Biology Integration:

    • Multi-omics data integration (genomics, transcriptomics, proteomics, metabolomics)

    • Network analysis to place y4jE in functional context

    • Comparative studies across multiple Rhizobium species and strains

  • Advanced Microscopy:

    • Super-resolution microscopy to track protein localization at nanoscale

    • Single-molecule tracking to observe dynamics in live cells

    • FRET-based approaches to confirm direct protein-protein interactions

  • Computational Validation:

    • Molecular dynamics simulations to test hypothesized interactions

    • Machine learning approaches to identify patterns in experimental data

    • Bayesian statistical methods to weigh conflicting evidence

  • Cross-validation Matrix:

HypothesisGenetic EvidenceBiochemical EvidenceStructural EvidenceIn Planta EvidenceConfidence Level
Function A+/-+++-Medium
Function B++-++Medium-High
Function C-+/-+/-++Medium-Low

This matrix approach helps researchers systematically evaluate the strength of evidence for each hypothesized function and identify areas requiring additional investigation.

What strategies can overcome solubility and stability challenges when working with recombinant y4jE?

Recombinant y4jE, like many bacterial proteins, may present solubility and stability challenges. The following methodological approaches can help address these issues:

  • Improving Solubility During Expression:

    • Lower induction temperature (16-18°C)

    • Reduce inducer concentration (0.1-0.5 mM IPTG)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ/GrpE)

    • Use solubility-enhancing fusion tags (MBP, SUMO, TRX) in addition to His-tag

    • Optimize codon usage for E. coli expression

  • Buffer Optimization:

    • Screen buffer components using differential scanning fluorimetry

    • Test various pH ranges (pH 6.0-9.0) to find optimal stability

    • Include stabilizing additives:

      • Glycerol (10-50%)

      • Trehalose (5-10%)

      • Arginine (50-200 mM)

      • NaCl (150-500 mM)

  • Storage Condition Optimization:

    • Aliquot and store at -80°C to prevent freeze-thaw cycles

    • For working aliquots, store at 4°C for no more than one week

    • When reconstituting lyophilized protein, use deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50%

  • Stability Assessment Methods:

    • Size-exclusion chromatography to monitor aggregation state

    • Dynamic light scattering to assess homogeneity

    • Thermal shift assays to evaluate buffer conditions

    • Limited proteolysis to identify stable domains

How can researchers validate experimental results when studying an uncharacterized protein like y4jE?

Validation of experimental results for uncharacterized proteins requires multiple complementary approaches:

  • Orthogonal Method Validation:

    • Confirm protein-protein interactions using at least two independent methods (e.g., yeast two-hybrid and co-immunoprecipitation)

    • Verify subcellular localization using fractionation and microscopy techniques

    • Cross-validate functional assays with both in vitro and in vivo approaches

  • Controls and Standards:

    • Include both positive and negative controls in all experiments

    • Use well-characterized proteins from the same family as benchmarks

    • Implement dose-response experiments to establish quantitative relationships

  • Statistical Rigor:

    • Perform experiments with sufficient biological and technical replicates

    • Apply appropriate statistical tests (ANOVA, t-tests) with correction for multiple testing

    • Use power analysis to determine adequate sample sizes

  • Validation Using Multiple Techniques:

Research QuestionPrimary TechniqueValidation Technique 1Validation Technique 2Confidence Level
Protein-protein interactionY2HCo-IPFRETHigh if all positive
Subcellular localizationGFP fusionImmunofluorescenceCell fractionationHigh if all agree
Enzymatic activityIn vitro assayIn vivo complementationSubstrate analog studiesMedium-high if 2/3 positive
  • Independent Validation:

    • Collaborate with other labs for independent replication

    • Compare results with related proteins in different Rhizobium species

    • Validate key findings using different expression systems or host organisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.