Recombinant Rhizobium sp. Uncharacterized protein y4jF (NGR_a03090)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Features

  • Gene locus: NGR_a03090 (synonym: y4jF) is located on the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234 .

  • Protein length: 519 amino acids (Full-length sequence) .

  • Domains: No experimentally confirmed domains, but sequence analysis reveals homology to uncharacterized bacterial proteins of unknown function .

  • Isoelectric point (pI): Unreported; predicted molecular weight ≈58 kDa .

Recombinant Expression

ParameterDetails
Expression hostEscherichia coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
ReconstitutionSterile deionized water; 0.1–1.0 mg/mL with 50% glycerol for stability

Functional Notes

  • No enzymatic or ligand-binding activity has been experimentally validated.

  • Hypothesized to interact with rhizobial effector proteins or secretion machinery due to genomic proximity to genes encoding type III/IV secretion systems .

Genomic Localization

  • Located on the 543-kbp symbiotic plasmid pNGR234a, which harbors genes critical for nodulation and nitrogen fixation .

  • Flanked by ORFs associated with:

    • Secretion systems: Type III effectors (e.g., nopP) .

    • Transcriptional regulation: Ros/MucR-family regulators .

Hypothesized Roles in Symbiosis

  1. Effector Interaction: Potential interaction with nodulation outer protein P (NopP), a key regulator of rhizobial infection in legumes .

  2. Infection Thread Formation: Indirect evidence links homologous lectin receptor kinases (e.g., AsNIP43) to infection thread development, though y4jF’s role is unconfirmed .

  3. Secretion System Component: May contribute to the strain’s extensive secretory network, which includes six type I and three type IV systems .

Current Use Cases

ApplicationDescription
Antigen ProductionUsed in ELISA and antibody generation due to high purity and solubility .
Structural StudiesTemplate for crystallography or NMR to resolve 3D conformation .
Functional ScreensCandidate for yeast two-hybrid assays to identify interacting partners .

Limitations

  • Lack of functional annotation limits mechanistic studies.

  • Commercial availability is restricted to research-grade material .

Future Directions

  • CRISPR Knockout Studies: Elucidate phenotypic impacts in Rhizobium symbiosis models.

  • Transcriptomics: Compare expression profiles under nitrogen-starved vs. symbiotic conditions.

  • Structural Biology: Resolve ligand-binding pockets or catalytic sites via cryo-EM.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this requirement in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
NGR_a03090; y4jF; Uncharacterized protein y4jF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-519
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03090
Target Protein Sequence
MALANFIDRAATAASQVLTDFHLGDFKAALEKQVVAVAFDDQAASCAEGQATLDLAVRLL ARLYPVLAILPLDSASSFQAQALERLAKSINPKIGIRRSGKSAMVCLVAGATRPSLRCTT FFIGSDGWAAKLSRTDPVGSGSSLLPYGAGAASCFGAANVFRTIFAAQLTGAELDPDIDL SLYSYNKTKARDARPVDLPVDLGETHLVGLGAIGHGALWALARQSGLSGRLHVVDHEAVE LSNLQRYVLAGQAEIGMSKAVLATTALRSTALEVEAHPLKWAEHVARRGDWIFDRVGVAL DTAADRLAVQGALPRWIANAWTQEHDLGISRHGFDDGQACLCCMYMPSGKSKDEHQLIAE ELGIPETHEQVKALLQTNAGVPNDFVVRVATAMGVPFEPLAPFVGQPLRSFYQQAICGGL VFQLSDGSRLVRTVVPMAFQSALAGIMLAAELVKHSAGFPMSPTTSTRVNLLRPLGSHLH DPKAKDSSGRCICSDEDFISAYRRKYGNSVEPLSNISAT
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium sp. uncharacterized protein y4jF (NGR_a03090) and what is its significance in research?

Rhizobium sp. uncharacterized protein y4jF (NGR_a03090), also referred to as NopL, is a type 3 effector protein specific to Rhizobium bacteria. It is delivered directly into host legume cells during symbiotic interactions through the type 3 secretion system . This protein has gained significant research interest because it represents a Rhizobium-specific effector that interferes with mitogen-activated protein kinase (MAPK) signaling pathways in host plants . Unlike some other rhizobial effectors, NopL lacks homologs in pathogenic bacteria, making it particularly valuable for understanding symbiosis-specific mechanisms .

Research on this protein provides insights into how symbiotic bacteria modulate host plant immune responses to establish successful nodulation. The protein's ability to antagonize nodule senescence in certain host plants makes it a key target for studies focused on improving nitrogen fixation efficiency in agricultural applications .

What are the recommended protocols for storage and handling of recombinant y4jF protein in laboratory settings?

For optimal results with recombinant y4jF protein, researchers should follow these storage and handling protocols:

Long-term storage:

  • Store lyophilized protein at -20°C/-80°C, where it maintains stability for approximately 12 months

  • For liquid preparations, store at -20°C/-80°C with a typical shelf life of 6 months

  • Add glycerol to a final concentration of 5-50% before freezing to prevent freeze-thaw damage

Working with the protein:

  • Briefly centrifuge vials before opening to collect contents at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Prepare small working aliquots to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Tris-based buffers with optimized pH are commonly used for protein stability

These careful handling procedures are essential to maintain the structural integrity and biological activity of the protein for experimental applications.

What is the functional role of NopL (y4jF) in Rhizobium-legume symbiosis?

NopL plays a sophisticated role in Rhizobium-legume symbiosis by modulating host defense responses to facilitate successful nodulation. Experimental evidence indicates that NopL antagonizes premature nodule senescence in Phaseolus vulgaris (common bean cv. Tendergreen) . When plants were inoculated with a nopL mutant strain (NGRΩ nopL), distinct necrotic areas rapidly formed in nodules, suggesting accelerated senescence compared to plants inoculated with the wild-type strain .

The protein's impact on symbiosis varies depending on the host plant species. In Flemingia congesta, the nopL mutant induced fewer nodules than wild-type NGR234, indicating that NopL positively affects nodulation in this host . This host-specific effect demonstrates the complex nature of effector-host interactions in determining symbiotic outcomes.

At the molecular level, NopL appears to suppress specific plant defense responses by interfering with MAPK signaling pathways that would otherwise trigger immune responses against the microsymbiont . This targeted modulation of host immunity represents a sophisticated strategy that allows Rhizobium to colonize host tissues without completely compromising the plant's defense capabilities against true pathogens.

How does NopL interfere with mitogen-activated protein kinase (MAPK) signaling?

NopL interferes with MAPK signaling through a substrate mimicry mechanism that effectively disrupts host defense signaling cascades. Experimental evidence from both yeast and plant systems provides insights into this mechanism:

In yeast cells expressing nopL, the mating pheromone (α-factor) response pathway was disrupted, indicating interference with a MAPK-dependent process . When expressed in Nicotiana tabacum cells, NopL suppressed cell death induced by overexpression of the MAPK gene SIPK (salicylic acid-induced protein kinase) or by SIPK DD (a constitutively active MAPK mutant) . These observations strongly suggest that NopL targets MAPK pathways.

The molecular mechanism appears to involve NopL acting as a decoy substrate. Mass spectrometry analysis confirmed four phosphorylated serine residues in NopL, all exhibiting a Ser-Pro pattern typical of MAPK substrates . This phosphorylation pattern suggests that NopL competes with endogenous MAPK substrates, diverting kinase activity away from host defense pathways.

Two-dimensional electrophoresis of purified NopLHis from yeast revealed at least nine different protein spots with varying isoelectric points, consistent with multiple phosphorylation states . This phosphorylation is functionally significant, as phosphorylated NopL likely sequesters MAPK activity or interferes with downstream signal transduction, ultimately suppressing defense responses that would impede symbiotic colonization.

What experimental approaches can be used to investigate NopL phosphorylation sites and their functional significance?

The investigation of NopL phosphorylation sites and their functional significance requires a multi-faceted experimental approach:

Phosphorylation Site Identification:

  • Mass spectrometry analysis following tryptic digestion to identify specific phosphorylated residues

  • Two-dimensional gel electrophoresis to separate different phosphorylated isoforms

  • Phospho-specific antibodies to detect particular phosphorylated epitopes

  • In vitro phosphorylation assays using purified MAPKs to confirm direct phosphorylation

Functional Analysis of Phosphorylation:

  • Site-directed mutagenesis to create serine-to-alanine variants at identified phosphorylation sites

  • Expression of phospho-mutants in plant or yeast cells to assess impact on MAPK pathway disruption

  • Complementation studies in nopL mutant Rhizobium strains with phospho-mutant variants

  • MAPK kinase inhibitors (e.g., PD98059) to validate the specificity of kinase-substrate interactions

Structural Consequences of Phosphorylation:

  • Circular dichroism spectroscopy to assess potential conformational changes upon phosphorylation

  • Limited proteolysis to identify structural alterations in phosphorylated versus non-phosphorylated forms

  • Protein-protein interaction studies (Y2H, pull-down assays) to determine how phosphorylation affects binding partners

These methodological approaches provide complementary information about how phosphorylation regulates NopL function in the context of plant-microbe interactions.

What is the comparative phenotypic effect of wild-type versus nopL mutant Rhizobium in different host plants?

The phenotypic effects of wild-type Rhizobium sp. NGR234 versus its nopL mutant derivative (NGRΩ nopL) vary significantly depending on the host plant, revealing the host-specific nature of this effector's function:

Optimizing heterologous expression systems for functional recombinant NopL requires addressing several key considerations:

Expression Host Selection:

  • E. coli systems provide high yields but may lack proper eukaryotic post-translational modifications

  • Yeast (S. cerevisiae) offers eukaryotic phosphorylation machinery but exhibits cytostatic effects due to NopL's interference with MAPK pathways

  • Plant cell cultures provide the most physiologically relevant modifications but typically with lower yields

Vector and Construct Design:

  • Include appropriate affinity tags (His, GST) for purification while minimizing interference with function

  • Consider codon optimization for the selected expression host

  • Employ inducible promoters (GAL1 for yeast) to control expression levels and mitigate cytostatic effects

  • Include protease cleavage sites to remove tags if needed for functional studies

Expression Conditions:

  • Optimize temperature, pH, and induction timing to balance yield with proper folding

  • For yeast expression, monitor growth inhibition and adjust induction protocols accordingly

  • Consider specialized media formulations to enhance protein solubility

Purification Strategy:

  • Implement multi-step purification protocols (affinity chromatography followed by size exclusion)

  • Use Ni-NTA affinity chromatography for His-tagged versions, which has proven effective for NopL

  • Consider ion exchange chromatography to separate differently phosphorylated forms

  • Validate purified protein by SDS-PAGE, Western blotting, and mass spectrometry

Functional Validation:

  • Confirm phosphorylation status through 2D gel electrophoresis or mass spectrometry

  • Verify biological activity through MAPK inhibition assays in plant or yeast cell systems

  • Assess proper folding using circular dichroism spectroscopy or limited proteolysis

These optimization strategies are essential for producing recombinant NopL that accurately represents the native protein's functional properties for downstream research applications.

What are the broader implications of NopL's MAPK inhibitory activity for understanding plant-microbe interactions?

The MAPK inhibitory activity of NopL has significant implications for understanding plant-microbe interactions beyond the Rhizobium-legume symbiosis:

NopL represents a fascinating case of evolutionary convergence in effector strategies. Despite being a Rhizobium-specific effector with no homologs in pathogenic bacteria, it targets MAPK signaling pathways similar to effectors from various plant pathogens . This convergent evolution suggests that modulation of host MAPK signaling is a critical requirement for diverse microbes interacting with plants, regardless of whether the relationship is pathogenic or mutualistic.

The protein provides insights into how symbiotic bacteria have evolved sophisticated mechanisms to fine-tune host defense responses rather than completely suppressing them. This balanced approach allows for successful colonization while maintaining the host's ability to defend against true pathogens, representing a key difference between symbiotic and pathogenic strategies .

Understanding NopL's mechanism offers potential applications in agricultural biotechnology. Knowledge of how this protein modulates plant immunity could inform strategies to enhance nodulation efficiency and nitrogen fixation in crops. Additionally, NopL could serve as a molecular tool for studying MAPK pathways across different plant species.

The host-specific effects of NopL (positive in Flemingia congesta, modulating nodule senescence in P. vulgaris) highlight how effector-host interactions shape symbiotic specificity . This provides valuable insights into the molecular determinants of host range in plant-microbe interactions, with implications for expanding the host range of beneficial microbes in agricultural settings.

How do the phosphorylation patterns of NopL compare with known MAPK substrates in plants?

NopL exhibits phosphorylation patterns that closely mimic those of native plant MAPK substrates, providing insight into its molecular mimicry strategy:

Several emerging technologies hold promise for advancing our understanding of NopL function in plant-microbe interactions:

CRISPR-Cas9 Genome Editing:

  • Generation of precise mutations in NopL phosphorylation sites within the Rhizobium genome

  • Creation of plant host lines with modified MAPK pathways to dissect specific NopL targets

  • Development of reporter systems integrated at genomic loci to monitor NopL activity in real-time

Advanced Imaging Techniques:

  • Live-cell imaging with fluorescently tagged NopL to track localization and dynamics in host cells

  • Super-resolution microscopy to visualize NopL interactions with specific cellular compartments

  • FRET/BRET systems to monitor NopL-MAPK interactions in living cells

Proteomics Approaches:

  • Proximity-dependent biotin labeling (BioID, TurboID) to identify the complete interactome of NopL in plant cells

  • Phosphoproteomics to comprehensively map changes in the host phosphorylation landscape upon NopL delivery

  • Targeted proteomics methods (PRM, MRM) to quantify specific phosphorylated forms of NopL during infection

Systems Biology Integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics to build network models of NopL's effects

  • Mathematical modeling of MAPK pathway perturbations to predict NopL's impact across different host species

  • Comparative analyses across multiple rhizobial strains and host plants to identify evolutionary patterns

Synthetic Biology Approaches:

  • Engineering chimeric NopL variants with domains from other effectors to create novel functions

  • Development of optogenetic tools based on NopL to enable controlled manipulation of plant MAPK signaling

  • Creation of minimal synthetic NopL derivatives that retain key functional properties for biotechnological applications

These emerging technologies, when applied to the study of NopL and related effector proteins, promise to reveal new insights into the molecular mechanisms of plant-microbe interactions and potentially lead to applications in sustainable agriculture.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.