Recombinant Rhizobium sp. Uncharacterized protein y4jG (NGR_a03080)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhizobium sp. Uncharacterized Protein y4jG (NGR_a03080)

The Recombinant Rhizobium sp. uncharacterized protein y4jG, encoded by the gene NGR_a03080, is a protein of interest due to its potential roles in symbiotic interactions and metabolic processes within Rhizobium species. Rhizobium bacteria are well-known for their ability to form nitrogen-fixing nodules with legume plants, playing a crucial role in agricultural ecosystems. Despite its designation as "uncharacterized," this protein may hold significant importance in understanding the complex interactions between Rhizobium and its plant hosts.

Background on Rhizobium Species

Rhizobium species, including Rhizobium leguminosarum and Rhizobium sp. NGR234, are renowned for their symbiotic relationships with legumes. These bacteria possess a wide array of secretion systems and genes involved in nodulation and nitrogen fixation . The genetic diversity within Rhizobium species allows them to adapt to different environmental conditions and host plants, making them versatile agents in agricultural biotechnology .

Characteristics of Recombinant Rhizobium sp. Uncharacterized Protein y4jG (NGR_a03080)

  • Storage Conditions: The recombinant protein should be stored at -20°C for extended periods. Repeated freezing and thawing is not recommended, and working aliquots should be kept at 4°C .

  • Functionality: While specific functions of y4jG are not well-documented, proteins within Rhizobium species often play roles in symbiosis, stress response, or metabolic pathways .

  • Genetic Context: The gene NGR_a03080 is part of the Rhizobium sp. genome, which includes various genes involved in symbiotic interactions and metabolic processes.

Research Findings and Potential Applications

Despite the lack of detailed research specifically on y4jG, studies on similar proteins within Rhizobium species highlight their importance in symbiotic relationships and plant growth promotion. For instance, proteins involved in nodulation and nitrogen fixation are crucial for enhancing plant productivity .

Table: General Characteristics of Rhizobium Proteins Involved in Symbiosis

Protein/FunctionRole in SymbiosisReference
NodE and NodBNodulation factors
GntR-like regulatorsTranscriptional regulation
Secretion systemsProtein secretion for symbiosis

Future Directions

Further research is needed to elucidate the specific functions and potential applications of the Recombinant Rhizobium sp. uncharacterized protein y4jG. This could involve bioinformatic analysis to predict its structure and function, as well as experimental studies to assess its role in symbiotic interactions or metabolic pathways.

References Frontiers in Microbiology: NopD of Bradyrhizobium sp. XS1150 Possesses SUMO Protease Activity. PMC: The uncharacterized SANT and BTB domain-containing protein SANBR. PMC: Rhizobium sp. Strain NGR234 Possesses a Remarkable Number of Secretion Systems. PMC: Lifestyle adaptations of Rhizobium from rhizosphere to symbiosis. PMC: Proteome Analysis Reveals a Significant Host-Specific Response in Rhizobium-legume Symbiosis. PubMed: New Rhizobium leguminosarum flavonoid-induced proteins revealed by proteome analysis. MDPI: Genomic Diversity in the Endosymbiotic Bacterium Rhizobium leguminosarum. GeneBioSystems: Recombinant Rhizobium sp. Uncharacterized protein y4jG. SciELO: Potential of Rhizobium sp.I3 and Agrobacterium sp.I37 in Producing Nodules to Stimulate Peanut Plant Growth.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
NGR_a03080; y4jG; Probable metalloprotease y4jG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03080
Target Protein Sequence
MSALEDVRTVALPRDCVSTVQAHLRSVGQQGHEGMALWVGVQQDQHFVIAETVIPAQRHI RTSDGVCVMVPAEELHRLNVWLYKRGLTLLAQIHSHPGRAYHSTTDDAYAVATTIGCLSL VVPNFAREPFDFAHVAAYRLDAKANWNEVPSAVLTRMITITS
Uniprot No.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.