Recombinant Rhizobium sp. Uncharacterized protein y4kB (NGR_a02930)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
NGR_a02930; y4kB; Uncharacterized protein y4kB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02930
Target Protein Sequence
MPRTTKRLLDKLREVEALRGDGRSPPRGMLSRFGKGMVAFLREYVRILAYHLSVGPFPRL SKIIAAVGLAVSGPGVLYKVIEAIIAGEVRNRGAVIATAKEEPFEFYTMTLIVGSGAAFV TALGVAAFLVLILKGRPSRSE
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for y4kB protein samples?

For optimal preservation of y4kB protein activity and integrity, store the protein at -20°C/-80°C. The shelf life varies by formulation: lyophilized preparations maintain stability for approximately 12 months, while liquid formulations remain stable for about 6 months when stored at these temperatures .

Working aliquots may be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and function. For samples requiring frequent access, prepare multiple small-volume aliquots during initial reconstitution rather than repeatedly freezing and thawing a single stock .

When transporting the protein between laboratory workstations, maintain cold chain conditions using ice or cold packs to prevent degradation. Additionally, storage containers should minimize exposure to light, particularly if fluorescent tags are incorporated into the recombinant protein .

What is the recommended reconstitution protocol for lyophilized y4kB protein preparations?

The recommended reconstitution protocol involves a systematic approach to maximize protein recovery and stability:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material collects at the bottom before opening.

  • Reconstitute the protein in deionized sterile water to achieve a final concentration between 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (typically 50% is recommended by suppliers) to enhance stability during storage.

  • Prepare multiple small-volume aliquots to minimize freeze-thaw cycles.

  • Store reconstituted aliquots at -20°C/-80°C for long-term storage or at 4°C for short-term use (up to one week) .

This protocol helps maintain protein integrity by preventing aggregation and denaturation that can occur during reconstitution and subsequent handling. For experiments requiring precise protein concentrations, verify the concentration after reconstitution using standard protein quantification methods such as Bradford or BCA assays.

What experimental design approaches are recommended for investigating the function of uncharacterized proteins like y4kB?

Designing robust experiments for uncharacterized proteins requires a systematic approach that controls variables while testing specific hypotheses about protein function. The recommended experimental design process includes:

  • Hypothesis formulation: Develop clear, testable hypotheses about potential functions based on sequence analysis, structural predictions, and phylogenetic relationships.

  • Variable identification: Define independent variables (e.g., protein concentration, environmental conditions, presence of potential cofactors) and dependent variables (e.g., enzymatic activity, binding affinity, phenotypic changes) .

  • Control implementation: Establish appropriate controls, including negative controls (e.g., inactive protein variants), positive controls (related proteins with known functions), and system controls to account for experimental variation .

  • Randomization: Implement randomization strategies to minimize systematic biases that could affect experimental outcomes .

Experimental Design ComponentImplementation StrategyKey Considerations
Independent VariablesSystematic manipulationUse concentration gradients, varied conditions
Dependent VariablesPrecise measurement methodsSelect quantifiable outputs relevant to hypothesized function
Control GroupsMultiple control typesInclude both positive and negative controls
RandomizationBlock randomizationDistribute samples to minimize systematic bias
ReplicationTechnical and biological replicatesEnsure sufficient statistical power

True experimental designs involving control and experimental groups with random assignment are preferred over quasi-experimental approaches. For y4kB specifically, comparative studies with proteins of similar structure or from related Rhizobium species can provide valuable functional insights .

How can proteomic screening be optimized for functional characterization of y4kB?

Proteomic screening offers powerful approaches for characterizing uncharacterized proteins like y4kB. Optimization of these methods includes:

  • Sample preparation: Homogenize tissue or bacterial cultures containing y4kB in appropriate buffers (e.g., SDT buffer containing 4% SDS, 100 mM Tris-HCl, 1 mM DTT, pH 7.6), followed by sonication and centrifugation to extract proteins while maintaining their integrity .

  • Fractionation strategies: Implement subcellular fractionation to determine localization, particularly given the potential membrane association suggested by the y4kB sequence.

  • Interaction profiling: Employ co-immunoprecipitation or proximity labeling approaches (BioID, APEX) to identify protein-protein interactions that may indicate functional pathways.

  • Quantitative analysis: Apply label-free or isotope-labeling techniques (TMT, iTRAQ, SILAC) to quantify differential expression under various conditions.

  • Statistical analysis: Establish appropriate statistical thresholds (fold-change ≤1.2 is commonly used) and apply corrections for multiple testing to identify significant changes .

For verification of proteomic findings, complementary molecular biology techniques such as qRT-PCR can validate expression patterns at the transcriptional level, while Western blotting with specific antibodies can confirm protein expression and abundance .

What approaches can be used to predict and verify potential membrane association of y4kB?

The amino acid sequence of y4kB contains hydrophobic regions that suggest potential membrane association. To investigate this property methodically:

  • Computational prediction: Apply transmembrane domain prediction algorithms (TMHMM, Phobius) to identify potential membrane-spanning regions. Analysis of the "GVAAFLVLILK" segment and other hydrophobic regions can predict membrane interaction propensity.

  • Subcellular fractionation: Separate bacterial cellular components into membrane, cytosolic, and periplasmic fractions, then analyze each for the presence of y4kB using Western blotting with anti-His antibodies (for recombinant tagged protein) .

  • Fluorescence microscopy: Express fluorescently-tagged versions of y4kB and observe localization patterns within bacterial cells, comparing with known membrane markers.

  • Membrane extraction assays: Test the resistance of y4kB to extraction by different detergents or high-salt conditions, which can indicate integral membrane proteins versus peripheral membrane-associated proteins.

ApproachMethodologyExpected OutcomeLimitations
Sequence AnalysisHydrophobicity plots, TM predictionIdentification of potential TM domainsPredictions may not reflect in vivo behavior
Subcellular FractionationDifferential centrifugation, Western blottingEnrichment in specific cellular fractionsCross-contamination between fractions
Fluorescence MicroscopyFusion proteins with GFP/RFPVisualization of cellular localizationTags may interfere with native localization
Membrane ExtractionDetergent/salt extraction seriesDifferential solubilization patternsMay disrupt protein-protein interactions

Site-directed mutagenesis of predicted membrane-interacting regions can further validate their functional importance by demonstrating altered localization or function when these regions are modified.

How can researchers design experiments to investigate potential roles of y4kB in Rhizobium-legume symbiosis?

Given that y4kB originates from Sinorhizobium fredii, a nitrogen-fixing bacterium known for establishing symbiotic relationships with leguminous plants, investigating its role in symbiosis requires specialized experimental approaches:

  • Expression profiling: Analyze the differential expression of y4kB during various stages of symbiotic establishment, from initial plant recognition to mature nodule formation, using RNA-Seq or qRT-PCR .

  • Mutant phenotype analysis: Generate knockout or knockdown mutants for the gene encoding y4kB and assess their ability to form effective nitrogen-fixing nodules compared to wild-type strains.

  • Complementation studies: Reintroduce the wild-type gene into mutant strains to confirm that observed phenotypic defects are specifically due to the absence of y4kB.

  • Protein localization during symbiosis: Track the localization of fluorescently-tagged y4kB during infection thread formation and bacteroid differentiation within nodules.

  • Interactome analysis: Identify plant and bacterial proteins that interact with y4kB during symbiosis using co-immunoprecipitation followed by mass spectrometry.

For each experimental approach, proper controls must be implemented, including uninoculated plants, plants inoculated with wild-type bacteria, and appropriate time-course sampling to capture dynamic changes during symbiotic establishment. Variable manipulation should include environmental factors known to affect symbiosis, such as nitrogen availability, pH, and temperature.

What statistical approaches are most appropriate for analyzing experimental data related to uncharacterized proteins?

Statistical analysis of data from experiments with uncharacterized proteins requires careful consideration of experimental design and data characteristics:

  • Hypothesis testing: Implement appropriate statistical tests based on data distribution and experimental design. For comparison between experimental and control groups, t-tests or ANOVA may be suitable for normally distributed data, while non-parametric alternatives should be considered for non-normal distributions .

  • Multiple testing correction: When performing multiple comparisons, as is common in proteomics and transcriptomics, apply correction methods such as Bonferroni, Benjamini-Hochberg, or false discovery rate (FDR) approaches to control for type I errors .

  • Effect size quantification: Beyond statistical significance, calculate effect sizes (e.g., fold changes, Cohen's d) to assess biological relevance. For proteomic studies, fold-change thresholds of ≤1.2 are often used alongside p-value cutoffs .

  • Multivariate analysis: Apply principal component analysis (PCA), hierarchical clustering, or partial least squares discriminant analysis (PLS-DA) to identify patterns in complex datasets generated from multi-variable experiments.

  • Power analysis: Conduct power analysis before experimentation to determine appropriate sample sizes needed to detect anticipated effects, particularly important when working with subtle phenotypes often associated with uncharacterized proteins.

Statistical reporting should include both descriptive statistics (means, standard deviations) and inferential statistics (test statistics, p-values, confidence intervals), with clear identification of the statistical tests applied and their assumptions.

What are the key challenges in studying uncharacterized proteins like y4kB and how can researchers address them?

Uncharacterized proteins present several unique research challenges that require specialized approaches:

  • Functional hypothesis development: Without known function, identifying appropriate assays is difficult. Address this by using bioinformatic approaches to predict potential functions based on sequence homology, structural predictions, or genomic context.

  • Experimental design complexity: Design experiments that can test multiple functional hypotheses simultaneously. Implement factorial designs that examine various conditions and potential functions in parallel .

  • Specific detection limitations: Generate recombinant proteins with affinity tags (as seen with His-tagged versions of y4kB) to facilitate detection and purification in the absence of specific antibodies .

  • Physiological relevance determination: Ensure experimental conditions mimic physiological environments as closely as possible. For y4kB, consider the bacterial environment both in free-living conditions and during plant symbiosis.

  • Negative results interpretation: Develop frameworks for interpreting negative results, which are common when working with proteins of unknown function. Use multiple methodological approaches to confirm negative findings.

Each challenge requires adaptable research strategies and willingness to pursue multiple lines of evidence simultaneously. Collaboration between researchers with expertise in bioinformatics, structural biology, biochemistry, and microbiology can provide complementary approaches to address these challenges.

How can researchers verify the expression and function of y4kB in experimental systems?

Verification of protein expression and function requires a multi-faceted approach combining molecular and biochemical techniques:

  • Transcript level verification: Quantify mRNA expression using qRT-PCR with gene-specific primers designed based on the y4kB sequence. Analyze transcript abundance using the comparative threshold cycle method as described in search result .

  • Protein level verification: Confirm protein expression using SDS-PAGE followed by Western blotting with antibodies against the recombinant tag (e.g., anti-His antibodies) or custom antibodies generated against the y4kB protein itself .

  • Functional validation: Design activity assays based on predicted functions from bioinformatic analysis. For proteins with unknown function like y4kB, consider broad screening approaches such as metabolite profiling or phenotypic screens of mutant strains.

  • Localization confirmation: Determine subcellular localization using fractionation followed by Western blotting or fluorescence microscopy with tagged protein variants.

  • Interaction partner identification: Validate potential protein-protein interactions using techniques such as co-immunoprecipitation, surface plasmon resonance, or bacterial/yeast two-hybrid systems.

PropertyRecombinant y4kB DetailsSource
UniProt IDP55522
SpeciesSinorhizobium fredii (strain NBRC 101917 / NGR234)
Amino Acid Length141 amino acids (full length)
Expression SystemsE. coli or Baculovirus
TagHis-tag
Purity>85-90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Shelf Life12 months (lyophilized), 6 months (liquid) at -20°C/-80°C

How can sequence analysis and structural prediction tools be applied to gain insights into potential functions of y4kB?

Computational approaches offer valuable insights into potential functions of uncharacterized proteins like y4kB:

  • Sequence homology analysis: Perform BLAST searches against protein databases to identify homologs with known functions. Even distant homology can provide functional clues.

  • Domain and motif identification: Analyze the y4kB sequence using tools like Pfam, PROSITE, or InterPro to identify conserved domains or motifs associated with specific functions.

  • Secondary structure prediction: Apply algorithms like PSIPRED or JPred to predict secondary structural elements (α-helices, β-sheets), which may suggest functional characteristics.

  • Tertiary structure prediction: Generate 3D structural models using tools like AlphaFold, I-TASSER, or Phyre2 based on the amino acid sequence. These models can reveal potential binding sites or catalytic regions.

  • Molecular dynamics simulations: Perform simulations to explore protein flexibility, potential binding sites, and interaction with membranes, particularly relevant given the potential membrane association of y4kB.

Combining these computational approaches with experimental validation provides a powerful strategy for functional hypothesis generation. For example, structural predictions might reveal a potential binding pocket that could be experimentally tested through site-directed mutagenesis and binding assays.

What methods can researchers use to study post-translational modifications of y4kB?

Post-translational modifications (PTMs) often play crucial roles in protein function, localization, and regulation. To investigate potential PTMs in y4kB:

  • Mass spectrometry-based detection: Use liquid chromatography-tandem mass spectrometry (LC-MS/MS) with enrichment strategies specific to PTMs of interest (phosphorylation, glycosylation, methylation, etc.).

  • Site-specific mutagenesis: Identify potential modification sites through bioinformatic prediction, then create mutant variants where these sites are altered to residues that cannot be modified (e.g., serine to alanine for phosphorylation sites).

  • PTM-specific antibodies: If common modifications are suspected, use commercially available antibodies that recognize specific PTMs (e.g., anti-phosphotyrosine antibodies).

  • Mobility shift assays: Detect PTMs through shifts in protein mobility on SDS-PAGE or native gels, particularly useful for modifications that significantly alter protein charge or size.

  • In vitro modification assays: Incubate purified y4kB with relevant enzymes (kinases, glycosyltransferases) and appropriate substrates to test for modification susceptibility.

For bacterially expressed recombinant proteins like those described in the search results, it's important to note that some PTMs present in the native bacterial environment may not occur in heterologous expression systems. Comparing proteins expressed in different systems may reveal functionally relevant modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.