Recombinant Rhizobium sp. Uncharacterized protein y4mM (NGR_a02460)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized in E. coli and purified via affinity chromatography leveraging the His tag. Post-purification, it is lyophilized in a Tris/PBS-based buffer with 6% trehalose (pH 8.0) to enhance stability . Reconstitution protocols recommend:

  • Dissolving in deionized sterile water (0.1–1.0 mg/mL).

  • Adding glycerol (5–50% final concentration) for long-term storage .

Genomic and Functional Context

NGR_a02460 is part of the genome of Sinorhizobium fredii NGR234, a strain noted for its broad host range in legume symbiosis. Key genomic insights include:

  • The NGR234 genome encodes extensive secretion systems (e.g., types I, III, IV) and metabolic pathways for aromatic compounds .

  • While NGR_a02460 itself is uncharacterized, related proteins in NGR234, such as NopB, are secreted via type III systems and influence host-specific nodulation .

  • The protein’s sequence contains domains suggestive of transmembrane or structural roles, though experimental validation is pending .

Research Applications

Despite its unknown function, this recombinant protein is utilized in:

  • Structural Studies: Investigating membrane protein architecture.

  • Antigen Production: Generating antibodies for microbial proteomics.

  • Symbiosis Research: Probing Rhizobium-legume interaction mechanisms .

Limitations and Future Directions

Current gaps include:

  • No confirmed enzymatic or ligand-binding activity.

  • Unresolved role in nitrogen fixation or secretion pathways.
    Further studies could employ knock-out mutants or interactome analyses to elucidate its biological significance .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
NGR_a02460; y4mM; Uncharacterized protein y4mM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
56-541
Protein Length
Full Length of Mature Protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02460
Target Protein Sequence
GTTLTLGHGAAPGNPRTVAAAKFAELVAEKTAGRVTINVAGAETLGSDAAMLTSLRTGAL DVTANSQGATSALVPELAALGLPFLFENTAKAMQVLGGPVGAELVKRFEAVGVVPLDWWD NGIRHLTNSKRKVAAPAEVSGMKIRTPADPMTMDIFQALGAATEQIAFGELYVALQQGVV DGQENPLANIDSSKLYEVNKYISLTGHKWESTPFLMSQIAQARLGGDLEAVKAAAKEAGE LQRKLSADKDAEVLAAFRRISAIEVTEVDREGFAKATASVVESRRSPSGISSPRSNRQPK AEALSAREHPMKSLSNLVELTARAIVWFARQVVIFSGIALMVFMTANVAARYVLAGGGFS FAQELPVLIFPWFILGGIVLAAHSGGHMAVEWIYDKLRDGARSTAFVAANLVSAGAFLML GYQAYLVGEIAGIEHSPVLQLPNSVGYFALAVGSVLVAIVTLAVALRVLRLGWDHRTNTE SGEVAL
Uniprot No.

Target Background

Database Links
Protein Families
Bacterial solute-binding protein 7 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is known about the protein structure and characteristics of NGR_a02460?

NGR_a02460 (y4mM) is an uncharacterized protein from Rhizobium sp., specifically identified in Sinorhizobium fredii. The full-length mature protein spans amino acids 56-541, with a complete protein sequence that can be recombinantly expressed with His-tag modifications . As an uncharacterized protein, its three-dimensional structure remains to be elucidated through crystallography or other structural biology approaches. The protein's molecular function, biological processes, and cellular components in which it participates have not been fully characterized, making it an interesting target for fundamental research in bacterial proteomics.

What expression systems are most suitable for producing recombinant NGR_a02460?

Multiple expression systems can be utilized for the recombinant production of NGR_a02460, each with distinct advantages:

Expression SystemAdvantagesConsiderationsRecommended Applications
E. coliHigh yields, short turnaround time, cost-effectiveLimited post-translational modificationsBasic characterization, antibody production
YeastBetter protein folding, some post-translational modificationsModerate yieldsFunctional studies requiring eukaryotic modifications
Insect cellsComplex post-translational modificationsLonger production timeStudies requiring authentic modifications
Mammalian cellsMost authentic post-translational modificationsHighest cost, complex proceduresStudies requiring mammalian-like modifications

E. coli and yeast systems consistently deliver the best yields and shorter turnaround times when expressing this protein . For initial characterization studies, E. coli-based expression is highly recommended due to its efficiency and established protocols for His-tagged protein purification .

Why are researchers interested in uncharacterized proteins from Rhizobium species?

Researchers are increasingly focused on uncharacterized proteins from Rhizobium species due to their potential roles in nitrogen fixation, plant growth promotion, and sustainable agriculture. Rhizobium bacteria, similar to their relatives like Bradyrhizobium, form symbiotic relationships with leguminous plants and can function as biofertilizers in sustainable legume-rice rotational cropping systems . Uncharacterized proteins like NGR_a02460 may contribute to:

  • Symbiotic nitrogen fixation mechanisms

  • Host-plant recognition and infection processes

  • Adaptation to diverse environmental conditions

  • Novel metabolic pathways relevant to agricultural applications

  • Bacterial survival as endophytes in non-leguminous plants

Understanding these proteins advances both fundamental microbiology and agricultural applications, particularly as interest grows in reducing chemical fertilizer dependence.

What is the optimal purification strategy for recombinant NGR_a02460?

The recommended purification strategy leverages the His-tag commonly incorporated into recombinant NGR_a02460 constructs :

  • Initial Capture: Immobilized Metal Affinity Chromatography (IMAC) using Ni-NTA or Co-NTA resins with optimized imidazole gradients to minimize non-specific binding

  • Intermediate Purification: Ion exchange chromatography based on the protein's predicted isoelectric point

  • Polishing Step: Size exclusion chromatography to achieve high purity and remove aggregates

For proteins intended for crystallography or interaction studies, consider tag removal using precision proteases followed by reverse IMAC. Typical purification yields from E. coli expression systems range from 10-15 mg per liter of culture when using optimized conditions. For confirmation of purity, SDS-PAGE analysis coupled with western blotting against the His-tag and mass spectrometry characterization should be performed.

How can I validate the identity and integrity of purified NGR_a02460?

A multi-faceted approach to validation is essential:

  • SDS-PAGE and Western Blotting: Confirms expected molecular weight (~54 kDa including tags) and immunoreactivity

  • Mass Spectrometry Analysis:

    • Intact protein mass measurement (MALDI-TOF or ESI-MS)

    • Peptide mass fingerprinting after tryptic digestion

    • Coverage analysis targeting at least 80% sequence coverage

  • N-terminal Sequencing: Confirms the correct start of the protein and absence of degradation

  • Dynamic Light Scattering: Assesses homogeneity and oligomerization state

  • Circular Dichroism: Provides secondary structure information and proper folding validation

These analytical techniques should be applied to freshly purified protein and after storage to ensure stability. Particular attention should be paid to potential proteolytic degradation, which can significantly impact functional studies of uncharacterized proteins.

What bioinformatic approaches can predict potential functions of NGR_a02460?

A comprehensive bioinformatic analysis workflow should include:

  • Sequence Homology Analysis:

    • BLAST searches against characterized proteins

    • Multiple sequence alignment with potential homologs

    • Phylogenetic analysis to identify evolutionary relationships

  • Domain and Motif Identification:

    • InterProScan to identify conserved domains

    • PROSITE for motif detection

    • Comparison with domain databases (Pfam, SMART, CDD)

  • Structural Prediction:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure-based function prediction using tools like ProFunc

    • Active site and binding pocket identification

  • Genomic Context Analysis:

    • Evaluation of neighboring genes and operonic structure

    • Comparative genomics across multiple Rhizobium strains

    • Coexpression data analysis if available

These in silico approaches provide testable hypotheses for experimental validation and can significantly accelerate functional characterization efforts for this uncharacterized protein.

How can I identify protein-protein interactions involving NGR_a02460?

Multiple complementary approaches should be employed to identify interaction partners:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express His-tagged NGR_a02460 in native Rhizobium or heterologous system

    • Perform crosslinking to capture transient interactions

    • Identify co-purifying proteins by LC-MS/MS

    • Use appropriate negative controls (unrelated His-tagged proteins)

  • Yeast Two-Hybrid Screening:

    • Construct bait plasmids with NGR_a02460

    • Screen against a library of Rhizobium proteins

    • Validate positive interactions through secondary assays

  • Protein Microarrays:

    • Probe Rhizobium protein arrays with labeled NGR_a02460

    • Identify specific binding partners

  • Bacterial Two-Hybrid Systems:

    • Particularly valuable for bacterial proteins in their native context

These experimental approaches should be combined with computational predictions from tools like STRING database to create a high-confidence interactome for NGR_a02460, providing crucial insights into its biological role in Rhizobium.

What methods can determine if NGR_a02460 plays a role in Rhizobium-plant symbiosis?

To investigate NGR_a02460's potential role in symbiosis, implement the following experimental approaches:

  • Gene Expression Analysis:

    • qRT-PCR or RNA-Seq comparing expression during:

      • Free-living growth vs. symbiotic stages

      • Different stages of nodule development

      • Various environmental stresses

  • Localization Studies:

    • Generate specific antibodies against NGR_a02460 using methods similar to those developed for Bradyrhizobium

    • Perform immunofluorescence microscopy to track protein localization during infection and nodule development

    • Create fluorescent protein fusions to monitor localization in live cells

  • Genetic Manipulation:

    • Generate knockout or knockdown mutants

    • Assess impact on:

      • Nodulation efficiency

      • Nitrogen fixation rates

      • Competitive ability against wild-type strains

    • Perform complementation studies to confirm phenotypes

  • Protein-Level Analysis:

    • Monitor protein abundance during symbiosis using targeted proteomics

    • Identify post-translational modifications specific to symbiotic states

These approaches, particularly when applied across multiple host plants, can reveal whether NGR_a02460 is essential for symbiosis or plays accessory roles in the Rhizobium-legume relationship.

How can I develop specific antibodies against NGR_a02460 for detection and monitoring?

Development of specific antibodies can follow several strategies:

  • Phage Display Antibody Technology:

    • Screen human phage display antibody libraries against purified NGR_a02460

    • Similar to the approach used successfully for Bradyrhizobium strains

    • Select specific binders through biopanning

    • Express as soluble single-chain variable fragments (scFv)

    • Validate specificity against other Rhizobium proteins

  • Polyclonal Antibody Production:

    • Immunize rabbits with purified recombinant NGR_a02460

    • Test for cross-reactivity with other bacterial proteins

    • Affinity-purify against immobilized antigen

  • Synthetic Antibody Alternatives:

    • Develop aptamers against NGR_a02460

    • Create nanobodies through immunization of camelids

The developed antibodies should be rigorously validated for specificity and sensitivity using ELISA and Western blotting against both recombinant protein and native Rhizobium lysates. For monitoring applications in agricultural settings, the antibodies should be tested in soil and plant samples with varying bacterial concentrations to establish detection limits.

What experimental design considerations are crucial when studying potential contradictory functions of NGR_a02460?

When investigating potentially contradictory functions of NGR_a02460, implement these design principles:

  • Systematic Hypothesis Testing:

    • Test multiple predicted functions simultaneously

    • Design experiments that can distinguish between alternative hypotheses

    • Utilize contradiction retrieval approaches as described in recent literature

  • Control Implementation:

    • Include positive and negative controls for each functional assay

    • Use wild-type, knockout, and complemented strains in parallel

    • Implement biological and technical replicates (minimum n=3)

  • Condition Variation:

    • Test function under multiple environmental conditions

    • Examine different growth phases and symbiotic stages

    • Consider host plant genotype effects

  • Multi-method Verification:

    • Apply complementary techniques to address the same question

    • Combine genetic, biochemical, and structural approaches

    • Use both in vivo and in vitro systems

  • Statistical Considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Use appropriate statistical tests with correction for multiple comparisons

    • Consider Bayesian approaches to integrate prior knowledge

This comprehensive experimental approach helps resolve apparent contradictions and builds a more coherent understanding of NGR_a02460's true biological functions.

How can structural biology approaches inform NGR_a02460 function prediction?

Structural biology provides crucial insights into function through these approaches:

  • X-ray Crystallography:

    • Optimize crystallization conditions for recombinant NGR_a02460

    • Determine high-resolution structure

    • Identify potential active sites and binding pockets

  • NMR Spectroscopy:

    • Characterize protein dynamics

    • Identify binding interfaces through chemical shift perturbation

    • Study interactions with potential ligands

  • Cryo-Electron Microscopy:

    • Particularly valuable if NGR_a02460 forms complexes

    • Visualize structural changes under different conditions

  • Structure-Guided Analyses:

    • Structure-based function prediction

    • Molecular docking with potential substrates

    • Molecular dynamics simulations to study flexibility

    • Structure-guided mutagenesis of predicted functional residues

  • Hydrogen-Deuterium Exchange Mass Spectrometry:

    • Map flexible regions and conformational changes

    • Identify potential regulatory mechanisms

These structural approaches can reveal unexpected similarities to proteins of known function even when sequence homology is limited, providing breakthrough insights into NGR_a02460's biological role.

How might NGR_a02460 contribute to improved biofertilizer development?

Understanding NGR_a02460's function could enhance biofertilizer development through several potential applications:

  • Strain Improvement:

    • If NGR_a02460 is involved in symbiotic efficiency, strains with optimized expression could be developed

    • Protein engineering based on structural insights might enhance beneficial functions

    • Creation of chimeric proteins combining functional domains from related species

  • Monitoring Applications:

    • Development of specific antibodies against NGR_a02460 could enable precise monitoring of inoculant persistence in soil

    • Quantitative assessment of Rhizobium populations in agricultural settings

  • Host Range Expansion:

    • If NGR_a02460 influences host specificity, modifications could potentially expand the range of plants that benefit from the bacterium

    • Development of strains compatible with non-traditional host plants

  • Stress Tolerance Enhancement:

    • If involved in stress response, overexpression might improve bacterial survival under field conditions

    • Engineering variants with enhanced stability under agricultural conditions

These applications depend on thorough functional characterization but represent the translational potential of basic research on proteins like NGR_a02460 in sustainable agriculture systems.

What methods can assess NGR_a02460 expression during plant-microbe interactions in field conditions?

Field-based expression analysis requires specialized approaches:

  • Antibody-Based Detection:

    • Develop immunofluorescence protocols similar to those used for Bradyrhizobium

    • Optimize for soil and plant tissue samples

    • Use confocal microscopy to visualize bacterial protein expression in planta

  • Molecular Detection:

    • Design NGR_a02460-specific qRT-PCR assays

    • Develop protocols for RNA extraction from soil and root nodules

    • Implement internal controls to normalize for bacterial abundance

  • Reporter Systems:

    • Create promoter-reporter fusions (GFP, LUX) to monitor NGR_a02460 expression

    • Compare expression in laboratory versus field conditions

    • Monitor expression dynamics over growing seasons

  • Proteomics Approaches:

    • Develop targeted proteomics assays for NGR_a02460 detection in environmental samples

    • Implement selective reaction monitoring (SRM) for quantitative analysis

    • Correlate protein abundance with symbiotic effectiveness

These methods should be validated in controlled environment chambers before field deployment and can provide valuable insights into the ecological relevance of NGR_a02460 in agricultural settings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.