Recombinant Rhizobium sp. Uncharacterized protein y4nH (NGR_a02340)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhizobium sp. Uncharacterized Protein y4nH (NGR_a02340)

Recombinant Rhizobium sp. Uncharacterized protein y4nH (NGR_a02340) is a protein of unknown function originating from Rhizobium sp., specifically strain NGR234 . The protein is also referred to as uncharacterized protein y4nH . The gene name is NGR_a02340, with the ORF name y4nH .

Key Characteristics:

  • Source: Rhizobium sp. strain NGR234

  • Locus Name: NGR_a02340

  • ORF Name: y4nH

  • UniProt Accession Number: P55580

  • Molecular Weight: Approximately 13.5 kDa (estimated)

  • Expression Region: Amino acids 1-117

Function and Role in Rhizobium sp.

As the name suggests, the function of the y4nH protein is currently uncharacterized . Rhizobium species are known for their symbiotic relationship with leguminous plants, where they fix nitrogen in root nodules . Several genes and proteins are involved in the nodulation process, including Nod factors .

Potential Areas of Research:

  1. Symbiosis: Investigating the protein's role in the symbiosis between Rhizobium and legumes .

  2. Protein Secretion: Examining whether y4nH is secreted via Type I secretion systems, similar to other proteins in Rhizobium .

  3. Regulation: Determining the regulatory mechanisms that control the expression of the y4nH gene .

  4. Metabolic Pathways: Elucidating the involvement of y4nH in metabolic pathways specific to Rhizobium .

Homologous Proteins and Conserved Domains

Bioinformatic analyses can reveal homologous proteins in other bacterial species, which may provide insights into the function of y4nH . Conserved domain searches can identify functional motifs within the protein sequence . These analyses can aid in predicting the biochemical activity of the protein.

Experimental Studies

To elucidate the function of y4nH, several experimental approaches can be employed:

  1. Gene Knockout/Mutation: Creating a knockout or mutant strain of Rhizobium sp. NGR234 lacking a functional y4nH gene and observing the resulting phenotype .

  2. Protein-Protein Interaction Studies: Identifying proteins that interact with y4nH using techniques such as yeast two-hybrid assays or co-immunoprecipitation .

  3. Transcriptomics and Proteomics: Analyzing gene expression and protein production in response to different environmental conditions or during symbiosis .

  4. Biochemical Assays: Performing in vitro assays to determine the enzymatic activity of the purified protein .

Relevance to Nitrogen Fixation

Rhizobium species play a crucial role in nitrogen fixation in leguminous plants . Investigating the function of uncharacterized proteins like y4nH can provide a better understanding of the molecular mechanisms underlying symbiotic nitrogen fixation. This knowledge can potentially be used to improve nitrogen fixation efficiency in agricultural systems.

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
NGR_a02340; y4nH; Uncharacterized protein y4nH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02340
Target Protein Sequence
MNAVPIILVFAAGLNSCIGNILLKWGRASLPPSAGLADTFLTPGFVGGVVFYGINVLLFA KALDSLEVSVAYPILAGSGFAMLIIASHYFFGEPFHLHKWIGVALVLVGIIFLARGG
Uniprot No.

Target Background

Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rhizobium sp. strain NGR234 and why is it significant for studying y4nH?

Rhizobium sp. strain NGR234 is an exceptional plant symbiont with extraordinary nitrogen-fixing capabilities. Unlike other rhizobia with limited host ranges, NGR234 can form nodules with more than 120 different legume genera and even the non-legume Parasponia andersonii . This exceptional versatility makes NGR234 an ideal model organism for studying plant-microbe symbiotic interactions.

The genome of NGR234 consists of three replicons: the chromosome (3.9 Mbp), the megaplasmid pNGR234b (2.42 Mbp), and the symbiotic plasmid pNGR234a (0.5 Mbp) . The symbiotic plasmid contains all genes necessary for establishing symbiosis and nitrogen fixation, including y4nH. Understanding this genetic architecture provides crucial context for studying y4nH's potential role in symbiosis.

Where is the y4nH gene located in the Rhizobium sp. NGR234 genome?

The y4nH gene (NGR_a02340) is located on the symbiotic plasmid pNGR234a of Rhizobium sp. NGR234. This 0.5 Mbp plasmid harbors genes crucial for establishing symbiosis and nitrogen fixation, including nodABCDEF (for Nod factor production), fix and nif genes (for nitrogen fixation), and tra genes (for conjugal transfer) .

Recent research has identified numerous previously unannotated small open reading frames (smORFs) on the pNGR234a plasmid, with sizes ranging from 33 nucleotides (10 amino acids) to 183 nucleotides (60 amino acids) . These findings highlight the complexity of this genetic resource and suggest that many proteins encoded on this plasmid may have unrecognized functions in symbiosis.

How are uncharacterized proteins in Rhizobium sp. identified and annotated?

Uncharacterized proteins in Rhizobium sp. NGR234 are typically identified through complementary genomic and transcriptomic approaches:

  • Initial identification involves ORF prediction software that identifies potential protein-coding sequences based on start and stop codons and minimal length thresholds.

  • These predicted ORFs are then mapped to transcriptomic profiles to determine if they are expressed under various conditions. For example, researchers have combined ORF searches with transcriptomic mapping to identify 251 previously unannotated small ORFs on pNGR234a .

  • Functional annotation begins with sequence similarity searches against characterized proteins in databases, followed by domain prediction and structural modeling.

  • For proteins with no significant sequence similarity to characterized proteins, transcription studies can determine if their expression depends on known regulators, such as TtsI for Type 3 secretion system-related genes .

  • Ultimately, experimental approaches such as phenotypic analysis of deletion mutants become essential for functional characterization, as demonstrated with the Y4lO protein, which was identified as a symbiotic determinant through mutation studies .

What expression systems are optimal for producing recombinant Rhizobium sp. proteins like y4nH?

Based on successful expression of other Rhizobium proteins, several expression systems could be suitable for y4nH:

  • Escherichia coli expression systems:

    • BL21(DE3) strains have been successfully used for high-level expression of Rhizobium proteins, as demonstrated with Y4lO protein .

    • For potentially toxic proteins or those requiring special folding conditions, specialized E. coli strains like Rosetta (for rare codon usage) may be more suitable.

  • Homologous expression in Rhizobium:

    • For functional studies where native protein interactions and modifications are crucial, expression in a related Rhizobium strain with the gene of interest deleted can provide physiologically relevant conditions.

The choice of vector is equally important:

  • pET vectors for T7-driven expression in E. coli

  • pGEX vectors for GST-fusion proteins that facilitate purification

  • Vectors with native Rhizobium promoters for homologous expression

When designing an expression construct for y4nH, consider adding affinity tags (His, GST) to facilitate purification, and include protease cleavage sites if the tag needs to be removed for functional studies.

How can the function of an uncharacterized protein like y4nH be determined?

Determining the function of an uncharacterized protein like y4nH requires a multifaceted approach:

  • In silico analysis:

    • Sequence homology searches against characterized proteins

    • Structural prediction and modeling to identify potential functional domains

    • Genomic context analysis to identify co-regulated genes

  • Gene knockout/mutation studies:

    • Create a targeted deletion or insertion mutation of y4nH in Rhizobium sp. NGR234

    • Compare phenotypes of wild-type and mutant strains in symbiosis with various legume hosts

    • Look for specific changes in nodulation, nitrogen fixation, or symbiotic efficiency

    • This approach was successful with Y4lO, where the NGRΩ y4lO mutant showed premature nodule senescence and abnormal infection droplet formation

  • Protein interaction studies:

    • Yeast two-hybrid screens to identify interaction partners

    • Co-immunoprecipitation followed by mass spectrometry

    • Bacterial two-hybrid systems for in vivo interaction detection

  • Biochemical characterization:

    • Activity assays based on predicted function

    • Structural studies using X-ray crystallography or NMR

    • Substrate specificity determination, similar to testing Y4lO's ability to acetylate mitogen-activated protein kinase kinases

  • Expression pattern analysis:

    • Determine conditions under which y4nH is expressed

    • Create promoter-reporter gene fusions to track expression patterns

    • Analyze if expression is dependent on known regulators (e.g., TtsI for T3SS-related genes)

What approaches can be used to study potential secretion of y4nH through bacterial secretion systems?

If y4nH functions as a secreted effector like Y4lO, several approaches can be used to study its secretion:

  • Bioinformatic prediction of secretion signals:

    • Analyze the protein sequence for Type 3 secretion signals, which are often located in the N-terminal region

    • Compare with known Type 3 effectors from Rhizobium and pathogenic bacteria

  • Reporter fusion assays:

    • Create translational fusions between y4nH and reporter proteins like adenylate cyclase (CyaA) or phosphatase (PhoA)

    • Test secretion by measuring reporter activity in culture supernatants or during plant infection

  • Direct detection of secreted protein:

    • Express epitope-tagged versions of y4nH

    • Analyze culture supernatants by immunoblotting to detect secreted protein

    • Perform proteomics analysis of secreted proteins

  • Secretion system mutant analysis:

    • Test secretion in wild-type versus Type 3 secretion system mutant backgrounds

    • The dependence of y4nH secretion on TtsI (Type 3 secretion system regulator) would suggest it functions as a Type 3 effector, similar to Y4lO

  • In planta localization:

    • Create fluorescently tagged versions of y4nH

    • Visualize protein localization during nodule development

    • Determine if the protein is translocated into plant cells

How might y4nH be involved in symbiotic relationships?

While the specific function of y4nH remains unknown, several hypotheses can be formulated based on characterized proteins in Rhizobium sp. NGR234:

  • Type 3 Secretion System (T3SS) effector:

    • If y4nH is secreted through the T3SS like Y4lO, it may modulate host cellular processes

    • It could be involved in suppressing host defense responses

    • It might influence nodule development or senescence

  • Symbiosome development regulator:

    • The Y4lO protein influences symbiosome development, with its absence leading to abnormal infection droplets and premature nodule senescence

    • Similarly, y4nH could regulate different aspects of symbiosome formation or maintenance

    • Ultrastructural analysis of nodules from y4nH mutants could reveal specific roles in bacteroid differentiation, similar to studies with Y4lO that showed "abnormal formation of enlarged infection droplets in ineffective nodules"

  • Host range determinant:

    • Given NGR234's exceptional host range, y4nH could function as a host-specificity factor

    • It might function in specific legume hosts but not others, contributing to the strain's adaptability

  • Quorum sensing-regulated effector:

    • If y4nH expression is regulated by quorum sensing like many symbiotic genes in NGR234

    • It could coordinate population-dependent behaviors during nodulation

Research approaches to test these hypotheses would include creating y4nH mutants and assessing their symbiotic phenotypes with various host plants, similar to the approach used with Y4lO, which revealed its role in preventing premature nodule senescence .

Could y4nH be regulated by quorum sensing mechanisms?

Quorum sensing (QS) plays a significant role in regulating symbiotic genes in Rhizobium sp. NGR234, and y4nH could potentially be under QS control:

  • QS systems in NGR234:

    • NGR234 contains two QS systems: NgrI/R on the chromosome and TraI/R on the symbiotic plasmid pNGR234a

    • NgrI produces 3-oxo-C12-HSL, while TraI produces 3-oxo-C8-HSL

    • A deletion of both AI synthases results in upregulation of nearly all genes on pNGR234a

  • Evidence supporting potential QS regulation of y4nH:

    • Many genes on the symbiotic plasmid show QS-dependent expression

    • An operon containing three small ORFs (repXYA) located between traI and repA is QS-regulated

    • If y4nH is located in a similar genomic context or contains QS-responsive promoter elements, it may be under similar regulation

  • Experimental approaches to determine QS regulation:

    • Promoter-reporter fusion studies to monitor y4nH expression in wild-type versus QS mutant backgrounds

    • Quantitative RT-PCR to compare y4nH transcript levels in response to exogenous autoinducers

    • RNA-seq analysis comparing expression in QS-proficient and QS-deficient strains

  • Potential functional implications:

    • QS regulation would suggest y4nH functions in population density-dependent processes

    • It could coordinate its expression with other symbiotic genes

    • The protein might be involved in later stages of symbiosis when bacterial populations have reached sufficient densities

What structural analysis techniques are most informative for uncharacterized proteins like y4nH?

Structural analysis of uncharacterized proteins like y4nH can provide crucial insights into potential functions:

  • X-ray crystallography:

    • Provides high-resolution structures for purified proteins

    • Requires successful crystallization of the protein

    • Can reveal active sites, binding pockets, and potential interaction surfaces

    • May identify structural similarities to characterized proteins, as done with GqqA, which showed structural similarity to PDT enzymes

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Suitable for smaller proteins in solution

    • Provides information about protein dynamics

    • Can identify flexible regions and conformational changes

    • Usually limited to proteins <30 kDa

  • Computational structural biology:

    • Homology modeling based on related structures

    • Ab initio modeling for novel folds

    • Molecular dynamics simulations to study protein motion

    • Tools like AlphaFold2 now provide remarkably accurate predictions

  • Structure-function analysis through mutagenesis:

    • Create mutations in predicted functional residues

    • Test the effect on protein function in vivo or in vitro

    • This approach has been successfully applied to GqqA, where mutagenesis followed by activity assays revealed key functional residues

  • Comparative structural analysis:

    • Compare y4nH structure with related proteins

    • Identify conserved structural features that might indicate function

    • For example, Y4lO shows sequence similarity to the YopJ effector family, suggesting potential functions

For y4nH specifically, a combination approach might be most informative: initial computational prediction followed by experimental validation and functional testing through mutagenesis.

How do you interpret contradictory results when characterizing novel proteins?

When characterizing novel proteins like y4nH, researchers often encounter contradictory results that require careful interpretation:

What bioinformatics tools are most useful for predicting the function of uncharacterized proteins?

Predicting the function of uncharacterized proteins like y4nH requires a comprehensive bioinformatics toolkit:

  • Sequence similarity and homology tools:

    • BLAST (Basic Local Alignment Search Tool) for identifying similar proteins

    • HHpred for remote homology detection using hidden Markov models

    • This approach helped identify Y4lO as having sequence similarities to T3 effectors from pathogenic bacteria (the YopJ effector family)

  • Protein domain and motif identification:

    • InterProScan for comprehensive domain analysis

    • PROSITE for motif identification

    • PFAM for protein family recognition

    • Functional domains often give strong indications of protein activity

  • Structural prediction tools:

    • AlphaFold2 for highly accurate protein structure prediction

    • I-TASSER for integrated structure and function prediction

    • Structure comparisons can reveal relationships not evident from sequence alone

  • Genomic context analysis:

    • Examining operonic structure and gene neighborhood

    • Analyzing if the gene is located near known symbiotic genes

    • Studies on pNGR234a have shown that gene location and context can provide important functional clues

  • Specialized tools for bacterial secretion:

    • EffectiveT3 for Type III secretion substrate prediction

    • Particularly relevant if y4nH might be a secreted effector like Y4lO

  • Promoter analysis:

    • Search for TtsI binding sites (tts boxes) that indicate T3SS-related genes

    • Identify potential quorum sensing-responsive elements

    • Transcription studies showed that Y4lO promoter activity depended on the transcriptional activator TtsI

A comprehensive approach combining multiple tools provides the most reliable predictions and generates testable hypotheses for experimental validation.

How can transcriptomic data help understand the role of y4nH?

Transcriptomic data provides valuable insights into the potential function of uncharacterized proteins like y4nH by revealing when and under what conditions the gene is expressed:

  • Expression pattern analysis:

    • Identify conditions that induce or repress y4nH expression

    • Compare expression patterns with known symbiotic genes

    • Determine if expression is host plant-specific

    • Track temporal expression during nodule development

  • Co-expression network analysis:

    • Identify genes with similar expression patterns

    • Construct correlation networks to find functional associations

    • Genes with similar expression profiles often participate in the same biological processes

  • Differential expression analysis:

    • Compare expression in wild-type versus mutant backgrounds

    • Analyze expression changes in response to host signals (e.g., flavonoids)

    • Examine expression in different plant hosts

    • For example, studies on Y4lO showed that its transcription was dependent on the transcriptional activator TtsI

  • Transcriptional regulation insights:

    • Identify potential regulatory elements in the y4nH promoter

    • Determine if y4nH is part of known regulons (e.g., NodD, TtsI, or QS regulons)

    • For example, if y4nH contains a tts box in its promoter region, it might be regulated similarly to Y4lO

  • Integration with mutant phenotype data:

    • Correlate expression changes with symbiotic outcomes

    • Identify genes whose expression is altered in y4nH mutants

    • This approach could reveal pathways affected by y4nH function

Experimental ConditionPurposeExpected Outcome if Involved in Symbiosis
Free-living vs. noduleDetermine if symbiotically inducedUpregulation in nodule
Early vs. late nodulationIdentify temporal expression patternStage-specific expression
Different host plantsAssess host-specificityDifferential expression based on host
± Flavonoid inductionTest for nod gene co-regulationCo-expression with nod genes
QS mutant backgroundsTest for QS regulationAltered expression in QS mutants

How do you design mutation studies for uncharacterized proteins?

Designing mutation studies for uncharacterized proteins like y4nH requires careful planning to maximize informative outcomes:

  • Gene deletion/disruption strategies:

    • Complete gene deletion to eliminate all protein function

    • Insertion mutations that disrupt the reading frame

    • In-frame deletions to remove specific domains while maintaining others

    Example from Y4lO research:

    • A complete gene knockout (NGRΩ y4lO) was created

    • This allowed researchers to observe dramatic phenotypic changes in nodule development, where "nodules induced by NGRΩ y4lO were first pink but rapidly turned greenish (ineffective nodules), indicating premature senescence"

  • Complementation studies:

    • Reintroduce the wild-type gene to confirm phenotypic restoration

    • Express the gene from a plasmid or integrate into a neutral genomic location

    • Include appropriate controls (empty vector, unrelated gene)

  • Site-directed mutagenesis:

    • Target predicted functional residues based on bioinformatic analysis

    • Create conservative versus non-conservative substitutions

    • Generate multiple mutants to test different hypotheses

  • Double mutant analysis:

    • Create double mutants with related genes to test genetic interactions

    • Example from Y4lO: The double mutant NGRΩ nopLΩ y4lO revealed that "Y4lO mitigated senescence-inducing effects caused by the T3 effector NopL, suggesting synergistic effects for Y4lO and NopL in nitrogen-fixing nodules"

  • Phenotypic analysis:

    • Test multiple host plants for symbiotic phenotypes

    • Examine nodule number, morphology, and nitrogen fixation efficiency

    • Use microscopy to assess bacterial infection and nodule ultrastructure

    • The Y4lO study demonstrated this approach by testing the mutant on multiple hosts and performing "ultrastructural analysis of the nodules induced by NGRΩ y4lO [which] revealed abnormal formation of enlarged infection droplets in ineffective nodules"

  • Experimental design considerations:

    • Include positive and negative controls

    • Verify mutant construction via sequencing

    • Confirm absence/presence of protein (Western blot)

    • Test multiple independent mutant isolates

What microscopy techniques are useful for studying the localization of Rhizobium proteins?

Understanding the localization of Rhizobium proteins like y4nH can provide crucial insights into their function. Several microscopy techniques are particularly valuable:

  • Fluorescence microscopy:

    • Fusion of the protein to fluorescent tags (GFP, mCherry)

    • Live-cell imaging to track dynamic localization

    • Multiple fluorescent proteins for co-localization studies

  • Confocal laser scanning microscopy:

    • Improved resolution and optical sectioning

    • 3D reconstruction of protein distribution in bacterial cells or nodules

    • Reduction of out-of-focus light for clearer images

  • Transmission electron microscopy (TEM):

    • Immunogold labeling for protein localization at ultrastructural level

    • High-resolution imaging of bacterial cells and symbiosomes

    • Particularly valuable for examining bacteroid differentiation

    • This technique was crucial in Y4lO research, revealing "abnormal formation of enlarged infection droplets in ineffective nodules" in NGRΩ y4lO mutant nodules, whereas "symbiosomes harboring a single bacteroid were frequently observed in effective nodules induced by NGR234 or NGRΩ nopLΩ y4lO"

  • Sample preparation considerations:

    • Live versus fixed samples

    • Maintaining rhizobia-legume interactions during imaging

    • Sectioning techniques for nodule samples

    • Avoiding artifacts during fixation and processing

  • Analysis approaches:

    • Compare protein localization in free-living bacteria versus bacteroids

    • Track changes in localization during nodule development

    • Determine if the protein localizes to the bacterial surface, is secreted, or remains cytoplasmic

    • Correlate localization with functional outcomes in symbiosis

How can interaction partners of y4nH be identified?

Identifying interaction partners is crucial for understanding the function of uncharacterized proteins like y4nH. Several complementary approaches can be employed:

  • Affinity purification-mass spectrometry (AP-MS):

    • Express tagged y4nH protein (His, FLAG, or TAP tag)

    • Purify under native conditions to maintain interactions

    • Identify co-purifying proteins by mass spectrometry

    • Include appropriate controls (untagged strain, irrelevant tagged protein)

  • Yeast two-hybrid (Y2H) screening:

    • Use y4nH as bait against prey libraries from Rhizobium and host plants

    • Screen for interactions using auxotrophic markers or reporter genes

    • Confirm interactions by reciprocal Y2H or other methods

  • Bimolecular fluorescence complementation (BiFC):

    • Split fluorescent protein reconstitution assay

    • Visualize interactions in living cells

    • Determine subcellular localization of interactions

    • Can detect interactions in plant cells during symbiosis

  • Co-immunoprecipitation (Co-IP):

    • Uses antibodies against y4nH or interacting partners

    • Can be performed with native proteins or tagged versions

    • Western blot detection of specific interacting partners

  • Bacterial two-hybrid systems:

    • Based on reconstitution of adenylate cyclase or other bacterial reporters

    • More suitable for bacterial proteins that may not fold properly in yeast

    • Can be performed in conditions more similar to native environment

  • Data analysis considerations:

    • Filter data for likely contaminants and abundant proteins

    • Prioritize interactions found by multiple methods

    • Validate key interactions using multiple techniques

    • Test functional relevance through genetic approaches

    • Consider potential plant and bacterial interaction partners separately

MethodAdvantagesLimitationsBest for
AP-MSIdentifies multiple partnersMay detect indirect interactionsGlobal interaction mapping
Y2HHigh-throughput, binary interactionsFalse positives, nuclear localization requiredInitial screening
BiFCVisualizes interactions in vivoIrreversible, potential artifactsConfirming localization
Co-IPWorks with native proteinsRequires good antibodiesValidating specific interactions

What are the most promising approaches for characterizing y4nH function?

Based on successful strategies used for other Rhizobium proteins, the most promising approaches for characterizing y4nH function include:

  • Comprehensive mutant analysis:

    • Create single and double mutants (with related genes)

    • Test phenotypes across multiple host plants

    • Perform detailed ultrastructural analysis of nodules

    • The success of this approach with Y4lO demonstrates its value, as mutant analysis revealed its role in preventing premature nodule senescence and proper symbiosome development

  • Expression studies:

    • Determine if y4nH is regulated by key symbiotic regulators (TtsI, NodD)

    • Analyze expression patterns during nodule development

    • Test if expression is quorum sensing-dependent, as many genes on pNGR234a are regulated by QS systems

  • Secretion and localization studies:

    • Determine if y4nH is secreted through the Type 3 secretion system

    • Analyze protein localization during symbiosis

    • Identify if the protein enters plant cells or remains in the bacterium

  • Structural analysis combined with targeted mutagenesis:

    • Determine protein structure through computational and experimental methods

    • Create targeted mutations based on structural predictions

    • Test the effect of mutations on protein function in vivo

  • Comparative genomics:

    • Analyze distribution and conservation of y4nH across different Rhizobium strains

    • Correlate presence/absence with host range or other symbiotic properties

    • Identify potentially co-evolved genes

How might y4nH research contribute to understanding symbiotic nitrogen fixation?

Research on uncharacterized proteins like y4nH has the potential to significantly advance our understanding of symbiotic nitrogen fixation:

  • Discovery of novel molecular mechanisms:

    • Uncharacterized proteins often reveal unexpected aspects of symbiosis

    • Y4lO research demonstrated this by revealing its role in preventing premature nodule senescence

  • Improved understanding of host specificity:

    • Proteins on pNGR234a often contribute to NGR234's exceptional host range

    • y4nH could be a determinant of compatibility with specific hosts

  • Insights into symbiosome development:

    • Many proteins encoded on pNGR234a are involved in bacteroid differentiation

    • Y4lO influences infection droplet formation and symbiosome development

    • y4nH might play a similar or complementary role

  • Uncovering regulatory networks:

    • Identifying how y4nH is regulated and what it regulates

    • Understanding its place in quorum sensing networks

    • Determining if it interacts with other symbiotic determinants

  • Potential biotechnological applications:

    • Enhanced inoculants for sustainable agriculture

    • Expanding host range of nitrogen-fixing bacteria

    • Improving symbiotic efficiency

What technical challenges remain in characterizing proteins like y4nH?

Despite advances in protein characterization methodologies, several technical challenges persist:

  • Expression and purification:

    • Obtaining sufficient quantities of soluble, correctly folded protein

    • Developing purification protocols that maintain native structure

    • Dealing with potential toxicity when overexpressed

  • Functional assays:

    • Developing assays for proteins with unknown activities

    • Distinguishing direct from indirect effects in complex symbiotic systems

    • Recreating the appropriate in vivo conditions for activity

  • Genetic redundancy:

    • Multiple proteins may have overlapping functions

    • Single mutants may not show clear phenotypes

    • Requires creation of multiple mutants to reveal function

  • Host plant variability:

    • Phenotypes may only be visible with specific host plants

    • Requires testing multiple legume species and cultivars

    • The Y4lO study demonstrated this challenge, as its effects were observed only in specific hosts like Tephrosia vogelii and certain cultivars of Phaseolus vulgaris and Vigna unguiculata

  • Technical difficulties in studying symbiosis:

    • Long experimental timeframes for nodulation studies

    • Complexity of plant-microbe interactions

    • Challenges in maintaining sterile conditions during long-term experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.