Recombinant Rhizobium sp. Uncharacterized protein y4nI (NGR_a02330)

Shipped with Ice Packs
In Stock

Description

Reconstitution Protocol

  1. Centrifuge: Briefly spin the vial to collect contents.

  2. Dilution: Reconstitute in sterile water to 0.1–1.0 mg/mL.

  3. Stabilization: Add 5–50% glycerol (v/v) for long-term storage.

  4. Avoidance: Repeated freeze-thaw cycles.

Host Strain Background

Sinorhizobium fredii NGR234 is a model rhizobial strain with exceptional symbiotic capacity, nodulating >120 legume species and non-legumes like Parasponia . Its genome encodes diverse secretion systems (e.g., type III, IV) critical for plant-microbe interactions . While NGR_a02330 resides on the chromosome (cNGR234), its role in symbiosis or environmental adaptation remains unclear .

Potential Functional Insights

  • Secretion Systems: NGR234’s genome includes genes for type I–IV secretion systems, though y4nI’s involvement in these pathways is unconfirmed .

  • Quorum Sensing: The strain employs acyl-homoserine lactone (AHL) signaling via TraI/TraR systems, but no direct link to y4nI has been reported .

Gaps and Future Directions

  1. Functional Annotation: Biochemical assays (e.g., enzyme activity, interaction mapping) are needed to classify y4nI.

  2. Symbiotic Role: Studies in legume hosts could reveal its impact on nodulation or nitrogen fixation.

  3. Comparative Genomics: Homologs in other rhizobia may provide clues about conserved functions.

References

  1. Creative BioMart. (2025). Recombinant Full Length Rhizobium Sp. Uncharacterized Protein Y4Ni (Ngr_A02330) Protein, His-Tagged.

  2. Schmeisser, C., et al. (2009). PubMed. Rhizobium sp. strain NGR234 possesses a remarkable number of secretion systems.

  3. Broughton, W.J., et al. (2003). PMC. Quorum sensing in Rhizobium sp. strain NGR234 regulates conjugative transfer and other interactions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NGR_a02330; y4nI; Uncharacterized protein y4nI
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a02330
Target Protein Sequence
MIVATLTPLWPLLDAEERPAVVSEVARSVTRSIALAPFHIRFAVESVSIVIGLCTVLISA GAGGPLARTLRTDRFYRLLQRMPGPAGSVIRLYRSMTLLAFYDEAPVAEKLLAARPAQTS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Rhizobium sp. uncharacterized protein y4nI (NGR_a02330)?

Rhizobium sp. uncharacterized protein y4nI (NGR_a02330) is a 120-amino acid protein (UniProt ID: P55581) from Sinorhizobium fredii that currently lacks definitive functional annotation. The protein is classified as "uncharacterized" because its biological role has not been experimentally confirmed despite its presence in the bacterial genome. It is typically produced as a recombinant protein with an N-terminal His tag expressed in E. coli for research purposes . The study of this protein falls within the broader context of Rhizobium biology, where these bacteria form nitrogen-fixing symbiotic relationships with leguminous plants through the development of specialized root nodules .

Why is functional annotation of uncharacterized proteins like y4nI important?

Functional annotation of uncharacterized proteins like y4nI is crucial for several fundamental reasons in molecular biology and microbiology research:

  • Genome completion: Annotating uncharacterized proteins helps provide a complete understanding of bacterial genomes and their encoded functionalities.

  • Pathway elucidation: Identifying the function of y4nI may reveal its role in critical pathways related to nitrogen fixation, symbiosis establishment, or other cellular processes in Rhizobium species.

  • Evolutionary insights: Functional annotation enables comparative genomic studies to understand evolutionary relationships and selective pressures.

  • Potential applications: As demonstrated with other uncharacterized proteins, functional annotation of y4nI could potentially reveal roles in symbiosis, virulence, or other important bacterial processes that might be valuable for agricultural applications .

The annotation process employs an integrated approach using multiple bioinformatic tools to predict physicochemical parameters, identify domains and motifs, locate subcellular positioning, and determine potential binding partners—all of which contribute to building a comprehensive functional profile of previously uncharacterized proteins .

What bioinformatic approaches are most effective for predicting the function of uncharacterized proteins like y4nI?

For predicting functions of uncharacterized proteins like y4nI, a multi-faceted bioinformatic approach yields the most reliable results:

  • Sequence-based analysis:

    • Homology searching using BLAST, PSI-BLAST, and HMM-based tools against multiple databases

    • Motif and pattern recognition using PROSITE, PRINTS, and BLOCKS

    • Domain prediction using Pfam, InterPro, and SMART

  • Structure-based prediction:

    • Ab initio modeling for proteins lacking known homologs

    • Homology-based structure prediction using Swiss-PDB and Phyre2 servers

    • Fold recognition for identifying potential structural analogs

  • Integrative approaches:

    • Protein-protein interaction prediction through string analysis to identify functional networks

    • Gene neighborhood and evolutionary profile analysis

    • Machine learning-based function prediction systems

The efficacy of these prediction methods can be evaluated using receiver operating characteristics (ROC) analysis, which has demonstrated accuracy levels of approximately 83% for function prediction parameters in similar uncharacterized protein studies . For y4nI specifically, examining potential structural similarities to known nitrogen-fixation related proteins or symbiosis factors would be particularly relevant given the Rhizobium context.

How can protein-protein interactions of y4nI be experimentally investigated?

Investigating protein-protein interactions of uncharacterized proteins like y4nI requires a strategic combination of computational prediction and experimental validation approaches:

Computational prediction methods:

  • String analysis to identify potential interaction partners based on genomic context, co-expression patterns, and evolutionary relationships

  • Structural docking simulations using the predicted 3D structure

  • Co-evolutionary analysis to identify residues that may participate in protein-protein interfaces

Experimental validation strategies:

  • Co-immunoprecipitation (Co-IP) with tagged recombinant y4nI

  • Yeast two-hybrid screening against Rhizobium or plant host protein libraries

  • Bimolecular Fluorescence Complementation (BiFC) for in vivo interaction visualization

  • Surface Plasmon Resonance (SPR) for quantitative binding analysis

  • Cross-linking mass spectrometry (XL-MS) to identify interaction surfaces

For y4nI specifically, investigating interactions with proteins involved in nitrogen fixation, nodulation, or plant signaling would be particularly relevant given its presence in Rhizobium species. The recombinant His-tagged version of the protein provides an excellent starting point for such experimental approaches, as it enables efficient purification and subsequent interaction studies .

What methods are recommended for subcellular localization determination of uncharacterized proteins?

Determining the subcellular localization of uncharacterized proteins like y4nI involves a strategic combination of computational prediction and experimental verification:

Computational prediction approaches:

  • Signal peptide prediction using SignalP

  • Transmembrane domain prediction using TMHMM, HMMTOP, or Phobius

  • Subcellular localization prediction through programs like TargetP, PSORT, or LOCTree3

  • Integrative prediction using meta-servers that combine multiple algorithms

Experimental verification methods:

  • Fluorescent protein fusion microscopy:

    • Creating GFP-y4nI fusion constructs

    • Expressing in Rhizobium cells

    • Visualizing localization using confocal microscopy

  • Cell fractionation and Western blotting:

    • Separating bacterial cell compartments (membrane, cytoplasm, periplasm)

    • Detecting y4nI using antibodies against the His-tag or the native protein

  • Immunogold electron microscopy for high-resolution localization

For Rhizobium proteins like y4nI, determining whether they localize to the bacterial membrane, cytoplasm, or are secreted through specific systems is particularly important as this significantly influences their potential roles in symbiosis establishment and nitrogen fixation processes . The presence of hydrophobic regions in the y4nI sequence suggests it might be membrane-associated, but experimental verification is essential.

What potential roles might y4nI play in Rhizobium-legume symbiosis?

While the specific function of y4nI remains uncharacterized, several hypothetical roles in Rhizobium-legume symbiosis can be proposed based on contextual understanding of this biological system:

Potential functional roles:

  • Signaling component: y4nI may participate in the complex signal exchange that occurs between Rhizobium and legume hosts during early symbiosis establishment.

  • Biofilm formation factor: Given the importance of biofilm formation in root colonization by Rhizobium species, y4nI could contribute to attachment processes or biofilm matrix development .

  • Membrane transporter: The protein's sequence characteristics might suggest involvement in transport of metabolites or signals across bacterial membranes.

  • Host-range determinant: Some uncharacterized proteins in Rhizobium contribute to host specificity by influencing recognition between specific bacterial strains and plant hosts.

  • Competitive advantage factor: Similar to characterized bacteriocins in Rhizobium, y4nI might contribute to competitive colonization of the rhizosphere .

Experimental investigation approaches:

To determine the actual role of y4nI, researchers should consider:

  • Creating targeted gene deletion mutants and assessing symbiotic phenotypes

  • Performing transcriptomic analysis to identify conditions under which y4nI is expressed

  • Conducting protein localization studies during different stages of nodule development

  • Heterologously expressing y4nI in model systems to assess specific hypothesized functions

Understanding the role of previously uncharacterized proteins has proven valuable in discovering new components of symbiotic pathways and potentially identifying novel targets for enhancing nitrogen fixation efficiency .

Could y4nI have bacteriocin-like properties similar to other characterized Rhizobium proteins?

The possibility that y4nI functions as a bacteriocin or bacteriocin-like protein warrants investigation based on several considerations:

Evidence supporting potential bacteriocin function:

  • Rhizobium species are known to produce bacteriocins that play roles in competition for nodule occupancy, as demonstrated with the characterized 248 rhizobiocin .

  • Bacteriocins can provide significant competitive advantages in the rhizosphere, with studies showing statistically significant reductions in nodule occupancy competitiveness for bacteriocin-deficient mutants .

  • The size of y4nI (120 amino acids) falls within the range observed for some small bacteriocins, though it is smaller than characterized RTX-containing bacteriocins (~100 kDa) .

Experimental approaches to test bacteriocin activity:

To investigate potential bacteriocin activity of y4nI, researchers should consider:

  • Growth inhibition assays:

    • Express and purify recombinant y4nI

    • Test activity against other Rhizobium strains and closely related bacteria

    • Assess calcium dependence of activity (characteristic of RTX-containing bacteriocins)

  • Molecular characterization:

    • Analyze the sequence for characteristic motifs found in bacteriocins

    • Perform Tn5 insertional mutagenesis to identify essential regions

    • Conduct domain analysis to identify potential calcium-binding sites

  • Competitive nodulation assays:

    • Create y4nI deletion mutants

    • Perform co-inoculation experiments with wild-type and mutant strains

    • Quantify nodule occupancy to assess competitive advantage

If y4nI does function as a bacteriocin, it could contribute to the ecological fitness of Rhizobium strains in soil environments and influence their success in establishing symbiotic relationships with host plants .

What crystallization approaches are recommended for structural determination of challenging uncharacterized proteins like y4nI?

Crystallizing uncharacterized proteins like y4nI presents significant challenges due to limited functional knowledge to guide optimization. A systematic approach combining multiple techniques offers the best chance of success:

Pre-crystallization optimization strategies:

  • Protein production optimization:

    • Expression system selection (bacterial, yeast, insect, mammalian)

    • Fusion tag variations beyond standard His-tag (MBP, GST, SUMO)

    • Codon optimization for expression host

    • Growth condition screening (temperature, media, induction parameters)

  • Protein engineering approaches:

    • Surface entropy reduction (SER) to replace high-entropy surface residues

    • Truncation constructs based on predicted domains

    • Stability enhancement through targeted mutations

    • Removal of flexible regions predicted by disorder prediction algorithms

Crystallization screening approaches:

  • High-throughput initial screening:

    • Commercial sparse matrix screens (500-1000 conditions)

    • Systematic grid screens varying pH, precipitants, and additives

    • Microseeding techniques to promote crystal nucleation

    • Lipid cubic phase crystallization for membrane-associated proteins

  • Advanced crystallization methods:

    • In situ proteolysis during crystallization

    • Counter-diffusion crystallization in capillaries

    • Crystallization in the presence of potential ligands or binding partners

    • Automated temperature-controlled crystallization trials

  • Alternative structural biology approaches:

    • Cryo-electron microscopy for proteins recalcitrant to crystallization

    • NMR spectroscopy for smaller domains of y4nI

    • Small-angle X-ray scattering (SAXS) for low-resolution envelope determination

What are the optimal conditions for expression and purification of recombinant y4nI?

The optimal expression and purification of recombinant y4nI requires careful optimization at each step of the process:

Expression optimization:

  • Expression host selection:

    • E. coli BL21(DE3) and derivatives are commonly used for basic expression

    • Consider specialized strains for:

      • Disulfide bond formation (SHuffle, Origami)

      • Rare codon supplementation (Rosetta, CodonPlus)

      • Membrane protein expression (C41/C43)

  • Vector and construct design:

    • N-terminal His-tag is standard for y4nI

    • Consider alternative tags (MBP, GST, SUMO) for solubility enhancement

    • Optimize codon usage for expression host

    • Include precision protease sites for tag removal

  • Culture conditions:

    • Test induction strategies (IPTG concentration: 0.1-1.0 mM)

    • Evaluate temperature reduction (37°C to 16-18°C) during induction

    • Assess media formulations (LB, TB, autoinduction media)

    • Optimize induction timing and duration

Purification protocol:

  • Cell lysis considerations:

    • Mechanical disruption (sonication, French press, homogenization)

    • Chemical lysis (detergents for potential membrane association)

    • Enzymatic treatments (lysozyme, nucleases)

  • Affinity purification:

    • IMAC (Ni-NTA) for His-tagged protein

    • Optimize binding and elution conditions

    • Consider on-column refolding for inclusion bodies

  • Secondary purification:

    • Size exclusion chromatography for final polishing

    • Ion exchange chromatography based on theoretical pI

    • Removal of His-tag if interfering with functional assays

  • Quality control:

    • SDS-PAGE to verify >90% purity

    • Mass spectrometry for identity confirmation

    • Dynamic light scattering for homogeneity assessment

Storage and handling:

The recombinant y4nI protein should be stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For long-term storage, addition of glycerol to 50% final concentration and storage at -20°C/-80°C is recommended. Avoid repeated freeze-thaw cycles by preparing single-use aliquots .

How can CRISPR-Cas9 be applied to study the function of y4nI in vivo?

CRISPR-Cas9 technology offers powerful approaches to investigate the function of uncharacterized proteins like y4nI in their native context:

CRISPR-Cas9 strategy for y4nI functional analysis:

  • Gene knockout approach:

    • Design sgRNAs targeting the y4nI (NGR_a02330) gene

    • Clone sgRNAs into a Cas9-expressing vector compatible with Rhizobium

    • Transform into Rhizobium and select for editing events

    • Confirm knockouts by sequencing and assess phenotypic changes in:

      • Growth characteristics

      • Biofilm formation capacity

      • Plant colonization efficiency

      • Nodulation kinetics and efficiency

      • Competitive fitness in mixed inoculation studies

  • CRISPRi for conditional knockdown:

    • Use catalytically inactive dCas9 fused to transcriptional repressors

    • Design sgRNAs targeting the y4nI promoter region

    • Create inducible systems to control timing of knockdown

    • Monitor phenotypic changes at different developmental stages

  • CRISPR-based tagging for localization and interaction studies:

    • Use CRISPR-mediated homology-directed repair to introduce fluorescent protein tags

    • Tag y4nI at its native locus to maintain physiological expression levels

    • Visualize protein localization during different growth conditions and symbiotic stages

  • CRISPRa for overexpression studies:

    • Use dCas9 fused to transcriptional activators

    • Target the y4nI promoter region to enhance expression

    • Assess phenotypic consequences of overexpression

Technical considerations for Rhizobium CRISPR applications:

  • Delivery systems:

    • Electroporation protocols optimized for Rhizobium

    • Conjugation-based transfer from E. coli donor strains

    • Transduction systems if applicable

  • Selection strategies:

    • Appropriate antibiotic markers for Rhizobium species

    • Counterselection systems for scarless editing

    • Screening methods to identify successful editing events

  • Off-target effect minimization:

    • Thorough sgRNA design with Rhizobium genome-specific tools

    • Whole-genome sequencing to verify specificity

    • Use of high-fidelity Cas9 variants

This CRISPR-based approach would complement traditional methods like Tn5 insertional mutagenesis that have been successfully used to characterize other Rhizobium genes .

How does y4nI compare to other uncharacterized proteins in symbiotic bacteria?

A comparative analysis of y4nI with other uncharacterized proteins in symbiotic bacteria reveals important patterns and distinctions:

Sequence-based comparisons:

  • Conservation analysis:

    • y4nI likely shows highest conservation among closely related Rhizobium and Sinorhizobium species

    • The level of conservation across more distant nitrogen-fixing bacteria could indicate functional importance

    • Analysis of selective pressure (dN/dS ratios) would reveal evolutionary constraints

  • Domain architecture comparison:

    • Unlike some larger uncharacterized proteins, y4nI's 120-amino acid sequence suggests a single-domain architecture

    • Comparison with other small proteins in symbiotic bacteria might reveal shared functional motifs

    • The presence/absence of signal peptides, transmembrane regions, or known binding motifs relative to other uncharacterized proteins provides functional clues

Genomic context analysis:

  • Gene neighborhood comparison:

    • Analyzing genes adjacent to y4nI across different Rhizobium species

    • Comparing synteny with other uncharacterized proteins in symbiotic bacteria

    • Identifying conserved gene clusters that might indicate functional relationships

  • Regulatory element analysis:

    • Comparison of promoter regions across homologs

    • Identification of shared transcription factor binding sites

    • Analysis of expression correlation patterns

Functional evidence comparison:

Protein Featurey4nI (NGR_a02330)Other Uncharacterized Rhizobium ProteinsFunctionally Annotated Rhizobium Proteins
Size (aa)120 Variable (typically 50-500)Variable
Known domainsNone confirmedVariablePresent
Expression patternUnknownOften condition-specificWell-characterized
Mutant phenotypesNot reportedVariableWell-characterized
ConservationTo be determinedVariableOften high in functional proteins
Interaction partnersUnknownFew identifiedMultiple identified

This comparative approach helps position y4nI within the broader context of symbiotic bacterial proteomes and can direct experimental efforts toward the most promising functional hypotheses based on similarities to better-characterized systems .

What computational approaches can predict if y4nI is involved in virulence or symbiosis?

Predicting whether y4nI functions in virulence or symbiosis requires sophisticated computational approaches that analyze multiple protein features:

Virulence prediction approaches:

  • Specialized virulence prediction tools:

    • VICMpred and VirulentPred algorithms evaluate sequence features associated with virulence factors

    • PAIDB searches for homology to known pathogenicity island components

    • MP3 combines sequence features with network properties

  • Effector prediction tools:

    • EffectiveT3 for type III secretion system substrate prediction

    • T4SEpre for type IV secretion effector prediction

    • SignalP and TatP for general secretion prediction

Symbiosis function prediction:

  • Co-expression network analysis:

    • Integration of transcriptomic data to identify genes co-expressed with known symbiosis factors

    • Differential expression analysis under symbiotic vs. non-symbiotic conditions

  • Phylogenetic profiling:

    • Correlation of protein presence/absence with symbiotic capability across bacterial species

    • Analysis of horizontal gene transfer patterns typical of symbiosis islands

  • Structural homology modeling:

    • Comparison with known symbiotic proteins at the structural level using tools like Phyre2

    • Binding site prediction for potential plant-derived ligands

Integrative prediction framework:

For a protein like y4nI, applying a consensus approach that integrates multiple prediction methods offers the most reliable results. An ROC analysis can evaluate the accuracy of different prediction tools, with previous studies on uncharacterized proteins demonstrating accuracy rates around 83% .

The methodological workflow should include:

  • Initial screening with specialized virulence and symbiosis prediction tools

  • Secondary validation with structural and functional domain analysis

  • Tertiary confirmation through genomic context and evolutionary analysis

  • Final consensus scoring to classify the protein's most likely functional category

These computational predictions should guide subsequent experimental investigations, particularly focused on plant-microbe interaction assays if symbiotic functions are predicted, or competition/inhibition assays if bacteriocin-like functions are suggested .

What integrated research strategy would most efficiently elucidate the function of y4nI?

An efficient integrated research strategy for elucidating the function of y4nI would combine computational prediction, molecular characterization, and phenotypic analysis in a logical progression:

Phase 1: Computational prediction and prioritization

  • Comprehensive bioinformatic analysis:

    • Sequence analysis for conserved domains and motifs

    • Structure prediction using tools like Swiss-PDB and Phyre2

    • Protein-protein interaction network prediction

    • Subcellular localization prediction

  • Hypothesis generation:

    • Formulate 2-3 most probable functional categories based on computational evidence

    • Design targeted experimental approaches for each hypothesis

Phase 2: Molecular characterization

  • Expression and purification optimization:

    • Express recombinant y4nI with appropriate tags

    • Optimize purification protocols for high yield and purity

    • Perform initial biochemical characterization (oligomeric state, stability)

  • Interaction studies:

    • Identify binding partners through pull-down assays and mass spectrometry

    • Validate key interactions through orthogonal methods

    • Characterize binding kinetics and specificity

  • Structural studies:

    • Attempt crystallization or NMR structural determination

    • Perform hydrogen-deuterium exchange mass spectrometry for dynamics

    • Use cryo-EM if the protein forms larger complexes

Phase 3: Functional validation

  • Genetic manipulation:

    • Generate clean deletion mutants using CRISPR-Cas9

    • Create complemented strains expressing wild-type and mutant variants

    • Develop conditional expression systems

  • Phenotypic characterization:

    • Assess growth under various conditions

    • Evaluate biofilm formation capacity

    • Test nodulation efficiency and nitrogen fixation rates

    • Perform competition assays for rhizosphere colonization

  • In planta studies:

    • Monitor bacterial behavior during plant colonization

    • Assess impact on symbiotic outcomes

    • Evaluate plant responses to bacterial inoculation

This integrated approach maximizes efficiency by using computational predictions to focus experimental efforts, while maintaining sufficient breadth to capture unexpected functions. The strategy emphasizes validation across multiple levels—molecular, cellular, and symbiotic—to build a comprehensive understanding of y4nI's biological role.

What are the most significant remaining challenges in characterizing uncharacterized bacterial proteins?

Despite advances in computational and experimental approaches, several significant challenges remain in characterizing uncharacterized bacterial proteins like y4nI:

Technical challenges:

  • Protein expression obstacles:

    • Many uncharacterized proteins express poorly or form inclusion bodies

    • Membrane-associated proteins present particular purification difficulties

    • Post-translational modifications may be essential but difficult to reproduce in heterologous systems

  • Functional assay limitations:

    • Without predicted function, developing appropriate activity assays is challenging

    • High-throughput functional screenings often miss subtle or context-dependent activities

    • Conditions under which the protein functions naturally may be difficult to replicate

  • Structural determination barriers:

    • Many uncharacterized proteins resist crystallization

    • Size limitations for NMR spectroscopy

    • Resolution limitations for cryo-EM of smaller proteins

Biological complexity challenges:

  • Functional redundancy:

    • Many bacterial proteins have partially overlapping functions

    • Single gene knockouts may show no phenotype due to compensation

    • Determining specific contribution within redundant systems requires sophisticated approaches

  • Context-dependent function:

    • Proteins may function only under specific environmental conditions

    • Host-microbe interface creates complex experimental systems

    • Temporal regulation may restrict function to specific developmental stages

  • Multi-functionality:

    • Many bacterial proteins perform different functions depending on context

    • Moonlighting functions may be overlooked by targeted assays

    • Distinguishing primary from secondary functions requires integrated approaches

Future directions and solutions:

  • Integration of multi-omics data:

    • Combining transcriptomics, proteomics, metabolomics, and phenomics

    • Network-based approaches to position proteins within functional pathways

    • Machine learning methods to identify patterns across diverse datasets

  • Advanced genetic tools:

    • CRISPR interference for temporal and conditional regulation

    • Multiplexed genome editing to address redundancy

    • In vivo proximity labeling to capture context-specific interactions

  • Community-based approaches:

    • Standardized pipelines for characterization attempts

    • Data sharing platforms for negative and positive results

    • Cross-species comparative analyses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.