Recombinant Rhizobium sp. Uncharacterized protein y4yS (NGR_a00520)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it; we will prioritize its development.
Synonyms
NGR_a00520; y4yS; Uncharacterized protein y4yS
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a00520
Target Protein Sequence
MNSHENRVAAPLLSFRLSLVLFAVLSVLPLGGCARWDNPVLSVKETSAAQLLGANQINAA TRQRILRAVGEDAQERALRDDLKQHPGNVDAAIRLTKALVAQKRPHEALQVLDNVLVVTP DNLRALNAKAVILDIEGRHDAAQELYRQALETNPENQMLHHNLHLSLAFEGKSEQRTLPQ SR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

How should Recombinant Rhizobium sp. Uncharacterized protein y4yS be properly stored and reconstituted?

For optimal protein stability and activity, the following protocols should be implemented:

Storage:

  • Store at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is the default recommendation)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

How does y4yS compare structurally and functionally to other uncharacterized proteins in Rhizobium sp.?

While y4yS (NGR_a00520) remains largely uncharacterized, comparison with other Rhizobium proteins offers insights into potential functional patterns:

ProteinLengthUniProt IDNotable Sequence FeaturesPotential Function Based on Homology
y4yS (NGR_a00520)182 aaP55727Signal peptide pattern in N-terminusPotential membrane-associated function
y4yQ (NGR_a00540)296 aaP55725Membrane-spanning regionsPotential transmembrane protein
y4xG (NGR_a00820)505 aaP55699Conserved enzymatic domainsPotential metabolic function

Unlike y4lO, which has been characterized as a symbiotic determinant with similarities to T3 effectors, y4yS has not yet been definitively linked to symbiosome differentiation or other specific functions . Research suggests these uncharacterized proteins may have roles in nitrogen fixation and plant-rhizobium interactions, but further experimental validation is needed.

What optimization strategies are recommended for expression and purification of Recombinant Rhizobium sp. y4yS protein?

When designing optimization experiments for expression and purification of recombinant y4yS, a Design of Experiments (DoE) approach is strongly recommended over the inefficient one-factor-at-a-time method. The DoE approach allows researchers to:

  • Identify the combined effects of multiple factors

  • Reduce experimental costs and time

  • Predict optimal conditions with statistical confidence

Recommended DoE Approach for y4yS Expression:

FactorLow LevelMid LevelHigh LevelUnits
IPTG concentration0.10.51.0mM
Temperature162537°C
Induction time41224hours
Media compositionMinimalLBRich-

Using response surface methodology allows identification of optimal expression conditions while accounting for interaction effects between variables. Software packages can facilitate experimental design and statistical analysis of results .

For purification optimization, consider similar factorial designs for buffer composition, imidazole gradients, and flow rates during His-tag affinity chromatography.

How can researchers assess the functionality of y4yS when working with an uncharacterized protein?

Working with uncharacterized proteins presents unique challenges. For y4yS, implementing a systematic functional assessment strategy is recommended:

  • Bioinformatic Analysis:

    • Conduct sequence similarity searches against characterized proteins

    • Predict structural domains and motifs

    • Identify potential binding partners through interactome analysis

  • Expression Pattern Analysis:

    • Examine transcriptional regulation patterns, potentially using approaches similar to those described for y4lO which showed dependence on the TtsI transcriptional activator

    • Analyze expression under different symbiotic conditions

  • Mutation Studies:

    • Generate targeted mutations in y4yS similar to the approach used for y4lO in NGR234

    • Assess phenotypic changes in symbiotic behavior with legume hosts

    • Examine ultrastructural changes in nodules through microscopy

  • Protein Interaction Studies:

    • Use pull-down assays with the His-tagged recombinant protein

    • Perform yeast two-hybrid or bacterial two-hybrid analysis

    • Consider crosslinking studies to identify transient interactions

The lack of characterized function makes these approaches exploratory, but systematic application can provide valuable insights into potential roles in symbiotic relationships.

What are the optimal conditions for long-term stability studies of recombinant y4yS protein?

For long-term stability assessment of recombinant y4yS protein, consider the following experimental design:

Stability Assessment Protocol:

  • Prepare multiple identical aliquots of purified protein following reconstitution guidelines

  • Store aliquots under varying conditions:

    • Different temperatures (-80°C, -20°C, 4°C)

    • Different buffer compositions (varying pH, salt concentrations, additives)

    • With and without cryoprotectants (glycerol at 10%, 30%, and 50%)

  • At defined intervals (1 week, 1 month, 3 months, 6 months, 1 year), thaw aliquots and assess:

    • Structural integrity (circular dichroism, thermal shift assays)

    • Purity (SDS-PAGE)

    • Aggregation state (size-exclusion chromatography)

    • Functional activity (if assays are developed)

  • Document all freeze-thaw cycles, as repeated freezing and thawing is not recommended

Based on existing storage recommendations, the default conditions (Tris/PBS-based buffer with 6% Trehalose, pH 8.0, stored at -20°C/-80°C with 50% glycerol) provide a starting point, but protein-specific optimization may improve long-term stability .

How might y4yS function in the broader context of Rhizobium-legume symbiosis based on current knowledge?

While y4yS remains uncharacterized, contextualizing it within the framework of known rhizobial symbiotic proteins provides valuable research directions:

Studies on the related protein y4lO from Rhizobium sp. strain NGR234 demonstrated its role as a symbiotic determinant involved in the differentiation of symbiosomes. Y4lO mitigated senescence-inducing effects, affecting nodule functionality in specific host legumes .

Given the organizational patterns of symbiotic genes in rhizobial genomes, hypotheses regarding y4yS function include:

  • Potential Type 3 Secretion System (T3SS) Effector:

    • Like y4lO, y4yS may function in host-specific interactions

    • Signal peptide patterns suggest potential secretion

    • May modulate host defense responses or cellular processes

  • Role in Symbiosome Development:

    • Could influence infection droplet formation or bacteroid differentiation

    • May affect nodule senescence timing or progression

    • Could function synergistically with other effectors like NopL

  • Host-Range Determination:

    • May influence host specificity through interaction with plant factors

    • Could affect nodulation in specific legume species

Research approaches should include comparative nodulation studies across diverse legume hosts using y4yS mutants, ultrastructural analysis of nodules, and protein localization studies during symbiosis establishment.

What crystallization strategies would be most effective for structural determination of y4yS?

Structural determination of uncharacterized proteins like y4yS presents unique challenges requiring systematic crystallization approaches:

Recommended Crystallization Strategy:

  • Protein Preparation Optimization:

    • Ensure high purity (>95%) through multi-step chromatography

    • Verify monodispersity through dynamic light scattering

    • Consider testing multiple constructs with varying N- and C-terminal boundaries

    • Explore tag-removal through protease cleavage sites

  • Initial Crystallization Screening:

    • Implement sparse matrix screening with commercial kits

    • Vary protein concentration (5-15 mg/ml initially)

    • Test multiple temperatures (4°C and 20°C)

    • Include both vapor diffusion and batch crystallization methods

  • Optimization Using DoE Approaches:

    • Apply factorial design to refine promising conditions

    • Systematically vary precipitant concentration, pH, and additives

    • Consider seeding techniques for crystal improvement

  • Alternative Approaches if Crystallization Fails:

    • Explore co-crystallization with potential binding partners

    • Consider surface entropy reduction mutations

    • Investigate NMR for solution structure if protein size permits

    • Utilize cryo-EM for larger assemblies or complexes

The methodical application of DoE principles to crystallization can significantly improve efficiency and success rates compared to traditional trial-and-error approaches .

How can researchers develop functional assays for an uncharacterized protein like y4yS?

Developing functional assays for uncharacterized proteins requires creative approaches based on bioinformatic predictions and experimental observations:

Functional Assay Development Strategy:

  • Bioinformatic-Guided Approaches:

    • Analyze predicted structural features for enzymatic active sites

    • Identify conserved domains with known functions in other proteins

    • Predict potential binding partners through interactome analysis

    • Assess subcellular localization signals

  • Comparative Functional Screening:

    • Test for activities common to related proteins (e.g., protein-protein interactions, DNA binding, enzymatic activity)

    • Assess potential involvement in signaling pathways similar to those affected by Y4lO

    • Consider testing for acetylation activity on mitogen-activated protein kinase kinases, as this was investigated for Y4lO

  • In planta Assays:

    • Develop plant infection assays using wild-type and y4yS mutant strains

    • Quantify nodulation efficiency across multiple host species

    • Measure nitrogen fixation rates in nodules

    • Analyze transcriptomic changes in plant hosts during infection

  • Phenotypic Screens:

    • Create mutation libraries of y4yS and screen for altered phenotypes

    • Perform suppressor screens to identify genetic interactions

    • Investigate environmental conditions that alter expression patterns

The y4lO study provides a valuable template, as it demonstrated that despite sequence similarities to pathogenic effectors, these proteins may have distinct substrate specificities and functions in symbiosis .

What are the common challenges in expressing and purifying recombinant y4yS and how can they be addressed?

Researchers frequently encounter specific challenges when working with recombinant y4yS protein:

ChallengePotential CausesRecommended Solutions
Low expression yieldCodon bias in E. coli
Protein toxicity
Improper induction conditions
Use codon-optimized sequence
Use tightly regulated expression systems
Optimize induction parameters using DoE
Protein insolubilityImproper folding
Hydrophobic regions
Inclusion body formation
Lower expression temperature (16°C)
Use solubility tags (SUMO, MBP)
Test different E. coli strains (e.g., Rosetta, Arctic Express)
Impurities after purificationNon-specific binding to resin
Protein degradation
Co-purifying chaperones
Increase imidazole in wash buffers
Add protease inhibitors
Include additional purification steps
Protein instabilityOxidation of cysteines
Proteolytic degradation
Aggregation
Add reducing agents (DTT, BME)
Store with protease inhibitors
Optimize buffer conditions (pH, salt, additives)

For each challenge, implementing a systematic DoE approach rather than changing one factor at a time will lead to more efficient optimization . When reconstituting the lyophilized protein, strictly follow guidelines to achieve 0.1-1.0 mg/mL concentration with appropriate glycerol addition as recommended .

How can researchers distinguish between functional effects of y4yS and experimental artifacts?

Establishing causality and distinguishing true functional effects from artifacts requires rigorous experimental controls:

  • Genetic Complementation:

    • Create a clean deletion of y4yS in Rhizobium sp.

    • Reintroduce the wild-type gene to restore function

    • Include point mutations in key residues to identify critical functional elements

    • Compare phenotypes across multiple experimental replicates and conditions

  • Dose-Response Relationships:

    • Test effects at varying protein concentrations

    • Establish concentration thresholds for biological responses

    • Confirm consistent response patterns across experimental setups

  • Control Experiments:

    • Use structurally similar but functionally distinct proteins as negative controls

    • Include heat-denatured protein samples to control for non-specific effects

    • Employ other uncharacterized proteins from the same organism as specificity controls

  • Cross-Validation Approaches:

    • Verify findings using multiple independent techniques

    • Confirm in vivo observations with in vitro reconstitution experiments

    • Use both gain-of-function and loss-of-function approaches

The research approach used for y4lO provides a model: the creation of both single (NGRΩ y4lO) and double (NGRΩ nopLΩ y4lO) mutants allowed researchers to distinguish individual and synergistic effects of these proteins in symbiosis .

What analytical methods are most suitable for characterizing potential post-translational modifications of y4yS?

Comprehensive characterization of post-translational modifications (PTMs) requires multiple complementary analytical approaches:

Recommended Analytical Workflow:

When investigating y4yS, particular attention should be paid to potential modifications that might occur during symbiotic interactions, as these could significantly impact protein function in host-specific contexts.

What novel applications of y4yS might emerge from further functional characterization?

Future research on y4yS could lead to several innovative applications pending its functional characterization:

  • Agricultural Biotechnology:

    • Engineering rhizobial strains with optimized y4yS expression to enhance nitrogen fixation

    • Developing y4yS variants with extended host range for non-traditional legume crops

    • Creating synthetic symbiosis systems incorporating y4yS functionality in non-legumes

  • Protein Engineering Applications:

    • Utilizing y4yS structural domains as scaffolds for designer proteins

    • Developing y4yS-based biosensors for monitoring plant-microbe interactions

    • Creating chimeric proteins with enhanced symbiotic capabilities

  • Therapeutic Potential:

    • If enzymatic activity is confirmed, exploring applications in protein modification

    • Investigating immunomodulatory properties for medical applications

    • Developing y4yS-inspired peptides with specific biological activities

  • Ecological Research Tools:

    • Using tagged y4yS variants to track rhizobial colonization in complex soil communities

    • Developing y4yS-based markers for monitoring symbiotic efficiency in field conditions

    • Creating diagnostic tools for rhizobial-legume compatibility assessment

The identification of y4lO as a symbiotic determinant suggests that y4yS and other uncharacterized proteins may have equally important roles in symbiosis that could be leveraged for sustainable agriculture applications .

How might interactions between y4yS and other symbiotic proteins be systematically investigated?

A comprehensive approach to mapping the protein interaction network of y4yS would include:

Interaction Mapping Strategy:

  • High-Throughput Screening Methods:

    • Yeast two-hybrid or bacterial two-hybrid systems

    • Protein microarray analysis with purified y4yS as bait

    • Co-immunoprecipitation coupled with mass spectrometry

    • Proximity labeling approaches (BioID, APEX) in vivo

  • Validation of Interactions:

    • Bimolecular fluorescence complementation in plant cells

    • Förster resonance energy transfer (FRET) analysis

    • Surface plasmon resonance for binding kinetics

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional Context Analysis:

    • Co-expression analysis under various symbiotic conditions

    • Epistasis studies with double and triple mutants

    • Competitive inhibition assays to map binding interfaces

    • Subcellular co-localization studies during symbiosis

  • Computational Prediction Integration:

    • Integrate experimental data with computational predictions

    • Develop machine learning models to predict additional interactions

    • Create dynamic network models of symbiotic protein interactions

The synergistic effects observed between y4lO and NopL indicate the importance of understanding protein interaction networks in symbiosis . Similar relationships may exist for y4yS that could inform our understanding of symbiotic processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.