Recombinant Rhizobium sp. Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Description

Enzymatic Characteristics and Catalytic Mechanism

UppP is an integral membrane protein localized near the periplasmic interface . Its active site involves:

  • Key Residues: His-30 and Arg-174, which form hydrogen bonds with pyrophosphate moieties . Mutagenesis studies show H30A and R174A mutants lose >90% activity .

  • Catalytic Motifs: The (E/Q)XXXE motif binds Mg²⁺, while PGXSRSXXT stabilizes substrate interactions .

Functional Roles in Bacterial Physiology

  • Cell Wall Synthesis: Essential for recycling UP, enabling lipid II cycle continuity .

  • Antibiotic Resistance: Confers bacitracin resistance by competing with the antibiotic for UPP binding .

  • Sporulation: Critical in Bacillus subtilis for spore cortex formation; ΔuppP mutants show 99.96% reduction in heat-resistant spores .

Table 2: Functional Impact of uppP Depletion

PhenotypeObservation
Cell MorphologyFilamentation, branching, and lysis
Sporulation EfficiencyReduced phase-bright spores (0.04% of wild type)
Bacitracin SensitivityIncreased susceptibility (MIC reduced by 50% in ΔbcrC mutants)

Species-Specific Variations

Homologs in Rhizobium etli (UniProt ID: B3PYJ1) share 84% sequence identity but differ in:

  • Amino Acid Length: 265 vs. 268 residues in Rhizobium sp. .

  • Expression Systems: Optimized in baculovirus or yeast for higher yields .

Research Findings and Mutagenesis Insights

  • Structural Modeling: Rosetta membrane ab initio simulations predict a periplasmic active site orientation .

  • Synthetic Lethality: Dual deletion of uppP and bcrC (another UPP phosphatase) is lethal, highlighting functional redundancy .

  • Regulatory Links: Connects to cell envelope stress response (CESR) via σᴹ-dependent pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
uppP; NGR_c36660; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-268
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
uppP
Target Protein Sequence
MADQSIISALVLGLIEGLTEFIPVSSTAHVLLAGHFLGFKSPGNTFAVLIQLGAILAILL VYFQKLLSIALALPTSVKARRFVFSVLIAFLPAALIGAAAHGFIKAVLFETPMLICVVLI VGGVILYAIDRLPLQPRYTDVFDYPPSLALKIGLFQCLAMIPGTSRSGATIAGALLMGTD KRSAAEFSFFLAMPTMLGAFTLDLYKNRDALSFDDIGVIAIGFIAAFVAGIVVVRSLLDF VSHRGFTPFAIWRIVVGTAGLVGLWLVG
Uniprot No.

Target Background

Function
This recombinant Rhizobium sp. undecaprenyl-diphosphatase (UppP) catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is undecaprenyl-diphosphatase (uppP) and what role does it play in bacterial cell wall biosynthesis?

Undecaprenyl-diphosphatase (uppP) is a critical membrane enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to undecaprenyl phosphate (UP). This conversion is essential for bacterial cell wall biosynthesis, particularly in the peptidoglycan synthesis pathway. UPP is produced from farnesyl diphosphate (FPP) through the action of undecaprenyl diphosphate synthase (UPPS), and then uppP converts UPP to UP, which serves as a membrane "anchor" for the formation of glycosylated products (Lipid I, Lipid II) that are subsequently converted to peptidoglycan cell wall components . This process is crucial for bacterial survival, making uppP an attractive target for antimicrobial development, especially since it is not present in humans.

Why are recombinant Rhizobium species valuable models for studying bacterial phosphatases like uppP?

Rhizobium species provide excellent model systems for studying bacterial phosphatases like uppP because they combine several advantageous characteristics. First, they have well-characterized genetic systems that allow for efficient gene manipulation and expression. Second, as soil bacteria that form symbiotic relationships with leguminous plants, they present a unique opportunity to study how cell wall modifications affect important ecological interactions . Third, Rhizobium species can be cultured relatively easily in laboratory settings, allowing for controlled experimental conditions. Additionally, the availability of complete genome sequences for many Rhizobium species facilitates comparative analyses and targeted genetic engineering, enabling researchers to create recombinant strains with modified uppP expression for detailed functional studies.

What are the most effective methods for constructing recombinant Rhizobium strains with modified uppP expression?

Several molecular approaches have proven effective for generating recombinant Rhizobium strains with modified uppP expression. The most reliable method involves using mini-Tn5 transposon systems, which allow for stable chromosomal integration of the modified uppP gene. This approach offers several advantages over plasmid-based systems:

  • Chromosomal integration: The mini-Tn5 transposon system enables integration of the uppP gene directly into the Rhizobium chromosome, avoiding the plasmid loss issues often encountered in bacteroids under non-selective conditions .

  • Stability: Once integrated, the modified gene remains stable without antibiotic selection pressure, making this approach suitable for field experiments and long-term studies.

  • Controlled copy number: Unlike multi-copy plasmids that can impose metabolic burdens on recipient strains, chromosomal integration provides a single copy of the gene, better mimicking natural expression levels.

The procedure typically involves:

  • Cloning the uppP gene with desired modifications into a pUT-derivative suicide vector

  • Introducing the construct into recipient Rhizobium strains via conjugation using E. coli S17-1λpir as the donor strain

  • Selecting transconjugants on appropriate media with spectinomycin resistance

  • Confirming integration via Southern blot analysis and PCR verification

This method typically yields transconjugants at a frequency of approximately 10⁻⁸ per recipient cell, with slight variations depending on the recipient Rhizobium species.

What expression systems yield optimal amounts of functional recombinant uppP protein?

For optimal expression of functional recombinant uppP from Rhizobium species, researchers should consider the following expression systems, each with distinct advantages:

Bacterial Expression Systems:

  • E. coli BL21(DE3): Most commonly used for initial studies, but membrane protein expression often results in inclusion bodies requiring refolding.

  • E. coli C43(DE3): Specialized strain for membrane proteins that reduces toxicity and improves folding.

  • Rhizobium native host: Expression in the native organism provides proper membrane insertion and post-translational modifications but yields lower protein amounts.

Expression Parameters for Optimal Activity:

  • Induction conditions: For E. coli systems, induction at lower temperatures (16-20°C) with reduced IPTG concentrations (0.1-0.3 mM) improves proper folding.

  • Membrane fraction isolation: Gentle cell lysis methods and proper detergent selection (typically n-dodecyl-β-D-maltoside or n-octyl-β-D-glucoside) are crucial for extracting active protein.

  • Fusion partners: Adding solubility tags such as MBP (maltose-binding protein) or fusion with bacteriorhodopsin can enhance stability and activity .

For functional studies, the EcUPPP-bacteriorhodopsin fusion approach has proven particularly effective, as it stabilizes the membrane protein in detergent-based assays while maintaining catalytic activity . This system has enabled detailed kinetic studies and inhibitor screening with reproducible results.

What are the recommended methods for measuring uppP enzyme activity in vitro?

Several robust methods exist for measuring uppP enzyme activity in vitro, each with specific applications:

1. Malachite Green Phosphate Detection Assay:

  • Principle: Measures inorganic phosphate released during the dephosphorylation reaction

  • Sensitivity: Detection limit of ~0.1 nmol phosphate

  • Advantages: Simple, colorimetric, adaptable to high-throughput screening

  • Protocol outline:

    • Incubate purified uppP with UPP substrate in buffer containing detergent

    • Stop reaction with acidic malachite green reagent

    • Measure absorbance at 620-650 nm

    • Calculate activity using a phosphate standard curve

2. Radiolabeled Substrate Assay:

  • Principle: Uses ³²P-labeled UPP to directly track substrate conversion

  • Sensitivity: Higher than colorimetric methods, detecting pmol quantities

  • Advantages: Direct measurement of actual substrate, fewer interference issues

  • Limitations: Requires radioisotope handling facilities

3. HPLC-based Assay:

  • Principle: Separates and quantifies substrate (UPP) and product (UP)

  • Advantages: Directly monitors both substrate depletion and product formation

  • Equipment: Requires reverse-phase HPLC system with C18 column

When using these assays with Rhizobium uppP, it's essential to include proper detergent mixtures (typically 0.1% DDM) and divalent cations (Mg²⁺ or Mn²⁺ at 5-10 mM) for optimal activity . Bacitracin serves as a useful positive control inhibitor with an IC₅₀ of approximately 32 μM against uppP enzymes.

How can researchers distinguish between direct uppP inhibition and other cellular effects in whole-cell assays?

Distinguishing direct uppP inhibition from indirect effects in whole-cell assays requires a multi-faceted approach:

1. Synergy Testing with Known Cell Wall Inhibitors:
Compounds that directly inhibit uppP typically show synergistic effects with other cell wall biosynthesis inhibitors. In one study, benzoic acid compound 7 (5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid) demonstrated significant synergy with seven antibiotics targeting cell wall biosynthesis (average FICI ~0.35) but showed indifferent effects with non-cell wall targeting antibiotics (average FICI ~1.45) . This pattern strongly suggests direct uppP inhibition.

2. Correlation Analysis:
Calculate correlation coefficients between:

  • Whole-cell growth inhibition

  • In vitro enzyme inhibition

  • Physicochemical properties (e.g., logD)

Strong correlation between enzyme and cell growth inhibition, with weaker correlations to logD, suggests direct target engagement. For reliable analysis, test at least 20-30 structural analogs .

3. Differential Inhibition Profile:
Compare inhibition patterns across:

  • Wild-type strains

  • uppP-overexpressing strains

  • Strains with mutations in the uppP active site

Compounds directly targeting uppP will show reduced efficacy against overexpression strains and altered potency against mutant strains.

4. Incorporation of Radiolabeled Precursors:
Monitor the incorporation of radiolabeled precursors into peptidoglycan. Direct uppP inhibitors will cause specific accumulation patterns of cell wall intermediates that differ from those caused by inhibitors of other pathways.

By combining these approaches, researchers can confidently distinguish direct uppP inhibition from off-target effects that may manifest similarly in whole-cell assays.

How does uppP inhibition affect symbiotic nitrogen fixation in Rhizobium-legume associations?

Inhibition of uppP in Rhizobium species has complex implications for symbiotic nitrogen fixation. The process affects multiple aspects of the symbiotic relationship:

1. Nodule Formation and Development:
UppP inhibition disrupts bacterial cell wall biosynthesis, which can alter the surface components necessary for proper recognition between rhizobia and legume roots. This can lead to delayed nodulation or formation of ineffective nodules, as proper cell wall components are essential for signal exchange during the early stages of symbiosis.

2. Bacteroid Differentiation:
Once inside nodules, rhizobia differentiate into nitrogen-fixing bacteroids, a process requiring extensive cell envelope remodeling. UppP inhibition during this stage can prevent proper bacteroid formation, resulting in nodules containing undifferentiated bacteria incapable of efficient nitrogen fixation. This is particularly significant because bacteroids have altered cell wall structures compared to free-living rhizobia.

3. Metabolic Impact:
Nitrogen fixation is an energy-intensive process requiring efficient carbon metabolism. Studies with recombinant Rhizobium strains suggest that perturbations in cell wall biosynthesis pathways can influence carbon allocation between bacterial maintenance and nitrogen fixation . Similar effects might be expected with uppP inhibition.

4. Hydrogen Recycling Connection:
Interestingly, hydrogen recycling capability (enabled by the hup gene cluster) can partially mitigate the effects of certain cell wall synthesis disruptions in some Rhizobium strains . This suggests complex metabolic interactions between cell wall integrity and energy conservation mechanisms that support nitrogen fixation.

When designing experiments to study these effects, researchers should monitor multiple parameters including nodule number, nodule morphology, leghemoglobin content, and acetylene reduction assays to comprehensively assess nitrogen fixation efficiency.

What structural features determine substrate specificity and inhibitor binding in Rhizobium uppP?

The substrate specificity and inhibitor binding properties of Rhizobium uppP are determined by several key structural features:

Substrate Binding Pocket Characteristics:

  • Hydrophobic Groove: A long, lipophilic channel accommodates the undecaprenyl (C₅₅) tail of the UPP substrate. This region shows conservation across bacterial species but may have Rhizobium-specific residues that influence the optimal substrate chain length.

  • Diphosphate Binding Site: Contains positively charged residues (typically arginine and lysine) that coordinate the diphosphate moiety through electrostatic interactions. The precise spatial arrangement of these residues influences phosphatase activity and selectivity.

  • Membrane-Interface Residues: Amphipathic amino acids at the membrane interface help position the enzyme correctly relative to the lipid bilayer, ensuring proper substrate access.

Inhibitor Binding Determinants:
Structure-activity relationship studies with benzoic acid inhibitors reveal that both lipophilicity and anionic character are essential for uppP inhibition . The most effective inhibitors share these features:

  • A hydrophobic side chain (typically 8-12 carbons) that mimics the undecaprenyl moiety

  • An anionic group (carboxylate or phosphonate) that interacts with the phosphate-binding site

  • Appropriate spacing between these elements

Compound 7 (5-fluoro-2-(3-(octyloxy)benzamido)benzoic acid) exemplifies these characteristics, showing potent inhibition (ED₅₀ ~0.15 μg/mL) against gram-positive bacteria . This compound likely binds in a mode that mimics the natural substrate, with its octyloxy chain occupying the hydrophobic tunnel and its carboxylate group engaging the phosphate-binding residues.

Understanding these structural determinants can guide the rational design of Rhizobium-specific uppP inhibitors for research applications or potential antimicrobial development.

How do environmental factors affect the expression and activity of uppP in Rhizobium species?

The expression and activity of uppP in Rhizobium species are significantly influenced by environmental conditions, which has important implications for experimental design:

Oxygen Concentration Effects:
Rhizobium species encounter varying oxygen levels during their lifecycle, particularly during nodule formation and symbiosis. UppP expression appears to be regulated in response to microaerobic conditions, similar to other membrane proteins involved in symbiosis. This regulation may involve transcriptional activators of the Fnr-FixK family, which respond to low oxygen conditions . In experimental settings, researchers should consider:

  • Controlling oxygen levels during growth and enzyme assays

  • Comparing uppP activity in aerobic versus microaerobic conditions

  • Examining potential cross-talk between oxygen-responsive regulators and uppP expression

pH and Ionic Conditions:
The activity of purified uppP shows a bell-shaped pH profile with optimum activity typically between pH 7.0-8.0. The enzyme requires specific divalent cations (Mg²⁺ or Mn²⁺) for maximal activity, and the optimal concentration of these ions may vary depending on membrane composition and experimental conditions.

Plant Signal Molecules:
During Rhizobium-legume symbiosis, plants release flavonoids and other signal molecules that trigger extensive bacterial gene expression changes. While direct effects on uppP expression haven't been thoroughly characterized, these plant signals could potentially modulate cell wall biosynthesis pathways during infection thread formation and bacterial release into nodule cells.

Nutrient Availability:
Carbon source and nitrogen availability influence the expression of many Rhizobium genes involved in cell wall synthesis. In particular, the availability of dicarboxylic acids, which are important carbon sources for bacteroids, may affect uppP expression patterns . This is relevant for experimental design, as different growth media compositions could yield varying baseline levels of uppP expression.

When studying uppP in Rhizobium species, researchers should carefully document and control these environmental parameters to ensure experimental reproducibility.

What statistical approaches are recommended for analyzing uppP inhibition data?

When analyzing uppP inhibition data, researchers should employ robust statistical methods that account for the complexities of enzyme kinetics and biological variability:

For IC₅₀ Determination:

  • Non-linear regression analysis using the four-parameter logistic model is the preferred approach for dose-response curves. This model accounts for:

    • Upper and lower plateaus

    • Hill slope (indicating cooperativity)

    • IC₅₀ value

    The equation is: Y = Bottom + (Top-Bottom)/(1+10^((LogIC₅₀-X)*HillSlope))

  • 95% confidence intervals should always be reported alongside IC₅₀ values to indicate precision. For uppP inhibitors, these intervals typically span 0.3-0.5 log units in well-designed experiments .

  • Replicate requirements: A minimum of three independent experiments with triplicate measurements is recommended for reliable IC₅₀ determination.

For Structure-Activity Relationship (SAR) Analysis:

  • Correlation analysis between enzyme inhibition and:

    • Structural parameters

    • Physicochemical properties (logD, PSA, etc.)

    • Whole-cell activity

    Pearson correlation coefficients (r) should be calculated, with values of r ≥ 0.7 generally indicating strong correlation .

  • Multiple linear regression can identify which molecular features contribute most significantly to inhibitory activity.

For Synergy Testing:

  • Fractional Inhibitory Concentration Index (FICI) calculation:
    FICI = (A/MIC_A) + (B/MIC_B)
    Where:

    • A = MIC of compound A in combination

    • MIC_A = MIC of compound A alone

    • B = MIC of compound B in combination

    • MIC_B = MIC of compound B alone

    Interpretation:

    • FICI ≤ 0.5: Synergistic

    • 0.5 < FICI ≤ 1.0: Additive

    • 1.0 < FICI ≤ 4.0: Indifferent

    • FICI > 4.0: Antagonistic

When reporting statistical results, always include the software package and version used for analysis, as well as any data transformations applied prior to analysis.

How can researchers address contradictory results in uppP inhibition studies?

When confronted with contradictory results in uppP inhibition studies, researchers should systematically investigate potential sources of variability and reconcile discrepancies through the following approaches:

1. Methodological Variations Analysis:
Create a comprehensive comparison table documenting all experimental conditions across studies, including:

  • Enzyme source and preparation method

  • Assay buffer composition (pH, ionic strength, detergent type/concentration)

  • Substrate source and purity

  • Detection method and instrumentation

  • Temperature and incubation time

Small variations in these parameters can significantly impact uppP activity measurements.

2. Substrate-Dependent Effects:
UppP activity can vary based on substrate characteristics:

  • Natural versus synthetic substrate analogs

  • Presence of detergent micelles versus liposomes

  • Substrate concentration relative to Km

Test inhibitors against multiple substrate presentations to determine if contradictions stem from substrate-dependent effects.

3. Isoform and Species Differences:
Rhizobial species may contain multiple uppP isoforms or variants with different inhibitor sensitivities. When comparing results across studies:

  • Confirm the exact gene/protein sequence being studied

  • Consider evolutionary relationships between the enzymes

  • Examine protein structure predictions for binding site differences

4. Off-Target Effects Assessment:
For whole-cell studies showing contradictory results:

  • Perform target validation using resistant mutants

  • Conduct metabolomics to identify alternative pathways affected

  • Test for membrane disruption effects that might mimic specific inhibition

5. Reconciliation Strategy:
When differences persist despite accounting for methodological variables:

  • Design bridging experiments that systematically vary one condition at a time

  • Collaborate with laboratories reporting different results to perform side-by-side comparisons

  • Consider publishing consensus papers that explicitly address and explain contradictions

This structured approach helps distinguish genuine biological or chemical phenomena from technical artifacts, advancing understanding of uppP inhibition mechanisms.

What bioinformatic tools are most effective for analyzing uppP sequence conservation and predicting functional regions?

For comprehensive analysis of uppP sequences and prediction of functional regions, researchers should utilize a multi-tool bioinformatic approach:

1. Sequence Alignment and Conservation Analysis:

  • MUSCLE and MAFFT: Optimized for membrane protein alignments, these tools correctly align transmembrane regions of uppP from diverse Rhizobium species.

  • ConSurf Server: Maps conservation scores onto protein structures, highlighting evolutionarily conserved residues likely to be functionally important in uppP.

  • Weblogo: Generates sequence logos that visually represent conservation patterns across uppP homologs, particularly useful for identifying catalytic site residues.

2. Structural Prediction and Analysis:

  • AlphaFold2: Currently provides the most accurate structural predictions for membrane proteins like uppP when experimental structures are unavailable.

  • SWISS-MODEL: Useful for homology modeling when templates with >30% identity are available.

  • TMHMM and TOPCONS: Predict transmembrane topology of uppP, crucial for understanding membrane insertion orientation.

  • CASTp and SiteMap: Identify potential binding pockets and catalytic sites in predicted uppP structures.

3. Functional Prediction Tools:

  • PROSPECT: Predicts functional effects of amino acid substitutions in uppP, helpful when analyzing natural variants.

  • 3DLigandSite: Predicts ligand binding sites based on similar structures, aiding identification of substrate and inhibitor binding regions.

  • Pfam and InterPro: Identify conserved domains in uppP sequences, placing them in broader functional context.

4. Evolutionary Analysis:

  • PAML: Detects sites under positive selection, potentially identifying residues involved in species-specific functions.

  • MEGA-X: Constructs phylogenetic trees of uppP sequences, revealing evolutionary relationships among Rhizobium species.

5. Integration and Visualization:

  • Chimera and PyMOL: Visualize predicted structures and map conservation, hydrophobicity, and other properties onto the 3D model.

  • Cytoscape: Creates interaction networks connecting uppP to other cell wall biosynthesis components.

When applying these tools to Rhizobium uppP sequences, researchers should account for the high membrane protein content and potential horizontal gene transfer events common in rhizobial genomes that might complicate evolutionary analyses.

What are promising strategies for developing selective inhibitors of Rhizobium uppP for research applications?

Developing selective inhibitors of Rhizobium uppP presents unique opportunities for advancing both fundamental research and agricultural applications. Several promising strategies emerge from current understanding:

1. Structure-Based Design Approaches:
Building on the success with benzoic acid derivatives, researchers should explore:

  • Hybrid molecules combining the lipophilic moieties of effective inhibitors (like compound 7) with rhizobia-specific binding elements

  • Peptidomimetics based on the bacitracin scaffold but modified for improved selectivity

  • Fragment-based approaches starting with the minimal pharmacophore (carboxylate/phosphonate group with hydrophobic tail)

These efforts should leverage computational docking against homology models of Rhizobium uppP to prioritize synthetic targets.

2. Exploiting Unique Features of Rhizobial Cell Envelopes:
Rhizobia possess distinct cell envelope characteristics compared to other bacteria:

  • Different lipopolysaccharide structures

  • Unique permeability properties

  • Specialized transport systems

Inhibitors can be designed to leverage these differences, potentially incorporating moieties that facilitate uptake specifically in rhizobia.

3. Conditional Inhibition Strategies:
For research applications, developing tools that allow controlled inhibition would be valuable:

  • Photo-activatable inhibitors that can be spatially and temporally regulated

  • Temperature-sensitive variants for conditional studies

  • Chemical genetic approaches using engineered uppP variants sensitive to specific compounds

4. Allosteric Modulators:
Rather than targeting the active site, researchers could develop:

  • Compounds binding to allosteric sites unique to Rhizobium uppP

  • Modulators that alter enzyme activity in response to specific environmental signals

5. Targeted Delivery Systems:
For studying uppP during symbiosis:

  • Plant-derived compounds or mimics that are activated only during nodulation

  • Inhibitors conjugated to nodule-specific targeting moieties

These strategies would enable more sophisticated dissection of uppP function in complex biological contexts than is currently possible with broad-spectrum inhibitors.

How might CRISPR-Cas systems be optimized for studying uppP function in Rhizobium species?

CRISPR-Cas systems offer powerful approaches for studying uppP function in Rhizobium species, but require specific optimizations for these bacteria:

1. CRISPR System Selection and Adaptation:

  • Cas9 variants: The smaller Staphylococcus aureus Cas9 (SaCas9) or Cas12a (Cpf1) systems may be preferable to SpCas9 for Rhizobium transformation efficiency.

  • Codon optimization: CRISPR components should be codon-optimized for Rhizobium to ensure efficient expression.

  • Promoter selection: Replace standard promoters with those active in Rhizobium, such as the constitutive nptII promoter or inducible nifH promoter for symbiosis-specific expression.

2. Delivery Methods for Rhizobium:

  • Conjugation-based approaches: Utilizing broad-host-range vectors with oriT regions for efficient transfer into Rhizobium strains .

  • Electroporation protocols: Optimized specifically for Rhizobium species with adjusted field strengths and buffer compositions.

  • Transposon-based integration: Combining CRISPR components with mini-Tn5 systems for stable chromosomal integration .

3. Gene Editing Strategies for uppP:

  • Complete knockout validation: Due to the essential nature of uppP, knockout attempts should include complementation controls.

  • Conditional depletion: CRISPRi approaches using dCas9 for tunable repression rather than complete deletion.

  • Precision editing: HDR templates designed with silent mutations that maintain uppP function but alter specific properties.

  • Multiple PAM site targeting: To overcome potential repair mechanisms in Rhizobium.

4. Specialized Applications:

  • CRISPRi for symbiosis studies: Inducible promoters controlling dCas9 expression to repress uppP specifically during nodulation.

  • Base editing: For introducing point mutations in uppP catalytic residues without double-strand breaks.

  • CRISPR activation: Using modified Cas systems to upregulate uppP expression under specific conditions.

5. Validation Strategies:

  • Phenotypic assays: Monitor changes in cell morphology, growth rates, and symbiotic capabilities.

  • Biochemical confirmation: Measure UPP phosphatase activity in membrane fractions.

  • Next-generation sequencing: Verify edits and check for off-target effects, particularly important in Rhizobium due to their complex, multipartite genomes.

These optimizations would enable more precise genetic manipulation of uppP in Rhizobium than traditional methods, advancing understanding of this enzyme's role in both free-living growth and symbiotic contexts.

What are the most significant unresolved questions about recombinant Rhizobium sp. uppP that warrant further investigation?

Despite significant advances in understanding recombinant Rhizobium sp. uppP, several critical questions remain unresolved and merit focused investigation:

1. Structural-Functional Relationships: How does the three-dimensional structure of Rhizobium uppP differ from other bacterial phosphatases, and how do these differences influence substrate specificity and inhibitor binding? While we have functional data on uppP inhibition , the lack of crystal structures for Rhizobium uppP limits our understanding of its precise catalytic mechanism and rational inhibitor design.

2. Regulation During Symbiotic Transitions: How is uppP expression and activity regulated during the transition from free-living to symbiotic states in Rhizobium species? The dramatic cellular remodeling that occurs during bacteroid differentiation likely involves changes in cell wall biosynthesis pathways, but the specific role of uppP in this process remains poorly characterized.

3. Metabolic Integration: How is uppP activity coordinated with other aspects of bacterial metabolism, particularly under the unique energetic constraints of nitrogen fixation? The connection between cell wall biosynthesis, carbon metabolism, and nitrogen fixation efficiency requires further elucidation, especially in light of observations that modifying certain metabolic genes can enhance symbiotic performance .

4. Species-Specific Variations: Why do different Rhizobium species show varying abilities to express heterologous phosphatases or adapt to phosphatase inhibition? The observation that some species successfully express foreign genes while others do not suggests underlying differences in cellular physiology or regulatory networks that remain to be explored.

5. Evolutionary Implications: How has uppP evolved in Rhizobium species compared to other bacteria, and what selective pressures have shaped its function? Comparative genomic and evolutionary analyses could reveal how this enzyme has been optimized for the unique ecological niche occupied by rhizobia.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.