Recombinant Rhizobium sp. UPF0314 protein NGR_c32320 (NGR_c32320)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us; we will prioritize its implementation.
Synonyms
NGR_c32320; UPF0314 protein NGR_c32320
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-197
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_c32320
Target Protein Sequence
MTIAAGTDDNRQRSTWIWLIACLGVVAIQILTQHLMGRLWICECGYVKLWEGVVNSSGNS QHISDWYTPSHIIHGFLFYGLGYLLLRGKPLSVRLLLATLIESAWEIAENTPMVINRYRS ATISLDYFGDSILNSTMDTLAMAAGFLLASRLPVAVTVTIAIVLELFTGWIIRDNLTLNV LMLVWPLDAVKAWQAGL
Uniprot No.

Target Background

Database Links
Protein Families
UPF0314 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage conditions for Recombinant Rhizobium sp. UPF0314 protein NGR_c32320?

For optimal preservation of protein activity and stability, Recombinant Rhizobium sp. UPF0314 protein NGR_c32320 should be stored at -20°C to -80°C for extended periods. The protein is typically supplied in a Tris/PBS-based buffer with 6-50% glycerol at pH 8.0, which helps maintain stability during freeze-thaw cycles. For working aliquots, storage at 4°C is recommended for up to one week. Multiple freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. When conducting experiments that require multiple uses of the protein, it is advisable to prepare small working aliquots from the stock solution to minimize repeated freezing and thawing .

How should Recombinant Rhizobium sp. UPF0314 protein NGR_c32320 be reconstituted for experimental use?

Prior to opening the vial containing lyophilized Recombinant Rhizobium sp. UPF0314 protein NGR_c32320, it should be briefly centrifuged to ensure all material is collected at the bottom. The recommended reconstitution protocol involves dissolving the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance stability, glycerol should be added to a final concentration of 5-50%, with 50% being the standard recommendation. After reconstitution, the solution should be gently mixed to ensure complete dissolution without causing protein denaturation. For long-term storage, the reconstituted protein should be aliquoted and stored at -20°C to -80°C to minimize freeze-thaw cycles .

What are the key considerations when designing experiments with Recombinant Rhizobium sp. UPF0314 protein NGR_c32320?

When designing experiments with Recombinant Rhizobium sp. UPF0314 protein NGR_c32320, researchers should carefully define their experimental variables and follow established experimental design principles:

  • Clearly define independent and dependent variables: For example, if studying protein-protein interactions, the independent variable might be the concentration of NGR_c32320, while the dependent variable could be binding affinity or interaction kinetics .

  • Incorporate appropriate controls: Include negative controls (e.g., buffer-only conditions), positive controls (known interacting proteins), and vehicle controls when testing potential inhibitors or enhancers of protein function.

  • Design with statistical power in mind: Include at least three replicates for each experimental condition to enable meaningful statistical analysis .

  • Consider protein stability: Since NGR_c32320 is sensitive to freeze-thaw cycles, design experiments to minimize the number of times the protein is thawed and refrozen.

  • Account for potential interference: The His-tag may influence protein behavior in some assays, so consider controls that address this potential confounding factor .

A well-structured experimental design table might look like:

Experimental GroupNGR_c32320 ConcentrationTreatment ConditionNumber of ReplicatesMeasurement Parameters
Control0 µg/mLBuffer only3[Parameters]
Low Concentration0.1 µg/mLExperimental3[Parameters]
Medium Concentration0.5 µg/mLExperimental3[Parameters]
High Concentration1.0 µg/mLExperimental3[Parameters]

What qualitative observations should be recorded when working with NGR_c32320 protein?

When conducting experiments with NGR_c32320 protein, systematic recording of qualitative observations is crucial for quality control and troubleshooting. Observations should be divided into those related to the procedure and those related to results, and should be documented before, during, and after the experiment .

A recommended observation table format:

Observation TypeBefore ExperimentDuring ExperimentAfter Experiment
Procedure- Solution clarity
- Equipment calibration
- Protein appearance
- Temperature fluctuations
- Timing variations
- Unexpected events
- Equipment performance
- Protocol deviations
- Cleanup observations
ResultsNot applicable- Initial protein behavior
- Unexpected reactions
- Color changes
- Final solution appearance
- Precipitation formation
- Stability observations

Remember that these qualitative observations can provide valuable insights into potential experimental errors and help in interpreting quantitative data. For example, observation of protein precipitation during an interaction assay could explain unexpected binding results .

How should quantitative data be organized and presented in NGR_c32320 protein research?

For research involving NGR_c32320 protein, quantitative data should be systematically organized in tables that facilitate analysis and interpretation. A recommended approach is to create a primary data table with individual trial results and a condensed table with calculated averages:

Primary Data Table Example for Protein-Protein Interaction Study:

Interacting ProteinTrial 1 (Binding Affinity, Kd nM)Trial 2 (Binding Affinity, Kd nM)Trial 3 (Binding Affinity, Kd nM)
Protein A45.243.846.1
Protein B128.3130.1125.7
Protein C2.52.32.8

Condensed Table (Averages):

Interacting ProteinAverage Binding Affinity (Kd nM) ± SD
Protein A45.0 ± 1.2
Protein B128.0 ± 2.2
Protein C2.5 ± 0.3

Sample calculation for average: (45.2 + 43.8 + 46.1)/3 = 45.0 nM

When presenting such data, attention to significant figures is essential. Measurements should be recorded with precision consistent with the capabilities of the instrumentation used, and averages should maintain the appropriate number of significant figures. Additionally, always include units of measurement and statistical parameters such as standard deviation or standard error where applicable .

What experimental approaches can be used to investigate the membrane localization properties of NGR_c32320?

The amino acid sequence of NGR_c32320 suggests potential membrane localization, as indicated by hydrophobic regions within the sequence (e.g., "LIACLGVVAIQILTQH"). To investigate this membrane association experimentally, researchers can employ several complementary approaches:

  • Subcellular Fractionation: Separate cellular components through differential centrifugation and analyze the presence of NGR_c32320 in membrane fractions versus cytosolic fractions using Western blotting with anti-His antibodies.

  • Fluorescence Microscopy: Create GFP-fusion constructs with NGR_c32320 to visualize its cellular localization in vivo. Compare wild-type localization patterns with those of mutants where hydrophobic regions are altered.

  • Membrane Protein Extraction Analysis: Use different detergents (mild to harsh) to extract NGR_c32320 from membranes, which can provide insights into the strength of membrane association.

  • Protease Protection Assays: Determine the topology of membrane-associated NGR_c32320 by subjecting intact membrane vesicles to protease treatment and analyzing which protein regions are protected.

An experimental design for subcellular fractionation might include:

FractionCentrifugation ConditionsExpected Result if Membrane-AssociatedControl Protein
Total LysateNoneNGR_c32320 presentGAPDH (cytosolic)
Cytosolic100,000×g supernatantNGR_c32320 absent/reducedGAPDH present
Membrane100,000×g pelletNGR_c32320 enrichedNa+/K+ ATPase present
Detergent-ExtractedTriton X-100 treatment of membrane fractionNGR_c32320 solubilizedVaries by membrane type

These experiments should be performed with appropriate controls, including known membrane and cytosolic proteins, to validate the fractionation procedure .

How can structural studies of NGR_c32320 be designed and optimized?

Structural studies of NGR_c32320 present unique challenges due to its potential membrane association. A comprehensive approach would include:

  • Protein Purification Optimization: The His-tagged recombinant protein provides a starting point, but further purification may be necessary for structural studies. Size exclusion chromatography can help ensure monodispersity of the sample.

  • Crystallization Trials: For X-ray crystallography, screening different buffer conditions, pH values, precipitants, and additives is essential. For a membrane-associated protein like NGR_c32320, inclusion of detergents or lipids may be crucial for maintaining native conformation.

  • NMR Spectroscopy Preparation: For solution NMR studies, isotopic labeling (15N, 13C) of the recombinant protein would be required. Expression conditions may need optimization to achieve sufficient yields of labeled protein.

  • Cryo-EM Sample Preparation: For membrane proteins, reconstitution into nanodiscs or liposomes may provide a more native-like environment for structural studies by cryo-electron microscopy.

A methodological approach to crystallization screening might include:

ParameterVariables to TestConsiderations for NGR_c32320
Buffer SystemsTris, HEPES, Phosphate, MES (pH 5.5-8.5)Test range around the storage buffer pH (8.0)
Salt Concentration0-500 mM NaCl, MgCl2, CaCl2Higher salt may help stabilize hydrophobic regions
PrecipitantsPEG (various MW), Ammonium sulfateStart with conditions successful for similar membrane proteins
DetergentsDDM, LDAO, C12E8, OGCritical for solubilizing membrane-associated regions
AdditivesGlycerol, MPD, small moleculesMay help stabilize protein conformation
Temperature4°C and 20°CLower temperatures often yield better crystals for membrane proteins

Optimization should proceed iteratively, with initial hits refined through systematic variation of successful conditions .

What approaches can be used to investigate potential interaction partners of NGR_c32320 in Rhizobium sp.?

Understanding the interaction network of NGR_c32320 is crucial for elucidating its biological function. Several complementary approaches can be employed:

  • Pull-down Assays: Utilize the His-tagged recombinant NGR_c32320 as bait to capture interacting proteins from Rhizobium sp. lysates. Captured proteins can be identified through mass spectrometry.

  • Yeast Two-Hybrid Screening: Create a library of Rhizobium sp. proteins and screen for interactions with NGR_c32320 using yeast two-hybrid systems. This may require constructing multiple bait constructs if NGR_c32320 has membrane-spanning regions.

  • Bacterial Two-Hybrid Systems: These may be more appropriate for bacterial proteins and can detect interactions in conditions more similar to the native environment.

  • Co-immunoprecipitation: Express tagged versions of NGR_c32320 in Rhizobium sp. and identify co-precipitating proteins after immunoprecipitation.

  • Proximity-Dependent Biotin Identification (BioID): Fuse NGR_c32320 to a biotin ligase that biotinylates proteins in close proximity, allowing identification of transient interaction partners.

A typical workflow for pull-down assays would include:

StepMethodControlsNotes for NGR_c32320
Bait PreparationNi-NTA purification of His-tagged NGR_c32320Purification of His-tag aloneEnsure protein is properly folded after purification
Prey PreparationPreparation of Rhizobium sp. lysatePre-clear lysate with Ni-NTA beadsConsider both soluble and membrane fractions
Binding ReactionIncubate bait with preyInclude no-bait controlTest various buffer conditions and detergents
WashingRemove non-specific bindersOptimize stringencyBalance between reducing background and maintaining specific interactions
ElutionRelease bound proteinsAnalyze beads-only controlConsider native elution (competition) and denaturing elution
AnalysisSDS-PAGE and mass spectrometryCompare with control pulldownsFocus on proteins enriched compared to controls

Validation of identified interactions should be performed using orthogonal methods such as bimolecular fluorescence complementation or FRET-based approaches .

What are common experimental errors when working with NGR_c32320 and how can they be addressed?

When conducting research with Recombinant Rhizobium sp. UPF0314 protein NGR_c32320, several experimental errors may arise. Understanding these potential pitfalls and their mitigation strategies is crucial for obtaining reliable results:

Common ErrorPotential ImpactMitigation Strategy
Protein degradation during storageLoss of activity, inconsistent resultsStore at recommended temperatures (-20°C to -80°C), minimize freeze-thaw cycles, add protease inhibitors
Incomplete protein solubilizationReduced apparent concentration, precipitationEnsure proper reconstitution protocol, optimize buffer conditions, consider detergents if membrane-associated
Tag interference with functionAltered activity or binding propertiesCompare with untagged versions where possible, use cleavable tags, position tags at different termini
Non-specific binding in interaction studiesFalse positive resultsInclude stringent controls, increase washing stringency, use competitive elution
Batch-to-batch variabilityInconsistent results across experimentsCharacterize each batch for purity and activity, normalize based on activity rather than concentration
Buffer incompatibilityProtein precipitation, loss of activityTest compatibility of experimental buffers with the storage buffer, perform gradual buffer exchange

For each experimental error, it's important to not only identify the issue but also understand how it may have affected your results. For example, protein degradation might lead to underestimation of activity, while non-specific binding could lead to false identification of interaction partners .

How can researchers validate the activity and specificity of NGR_c32320 in their experimental systems?

Validating the activity and specificity of NGR_c32320 is essential for ensuring experimental rigor. A comprehensive validation approach should include:

  • Purity Assessment: Confirm protein purity through SDS-PAGE analysis, with expected purity greater than 90% as specified in product information. Additional chromatographic methods may provide higher resolution assessment.

  • Structural Integrity Verification: Circular dichroism spectroscopy can verify that the recombinant protein maintains its secondary structure after purification and during experimental conditions.

  • Functional Assays: Although the specific function of NGR_c32320 is not fully characterized, preliminary assays based on predicted functions should be developed. For membrane proteins, this might include lipid binding assays or membrane integration studies.

  • Antibody Specificity: If using antibodies against the protein or tag, validate their specificity through Western blotting against both the recombinant protein and Rhizobium sp. lysates.

  • Comparative Analysis: When possible, compare the behavior of recombinant NGR_c32320 with the native protein extracted from Rhizobium sp.

A methodical approach to activity validation might proceed as follows:

Validation StepMethodExpected OutcomeTroubleshooting
Size VerificationSDS-PAGESingle band at ~22 kDa (protein + His-tag)If multiple bands appear, consider protein degradation or contamination
Identity ConfirmationWestern blot with anti-His antibodySpecific recognition of the recombinant proteinLack of signal may indicate tag inaccessibility or degradation
Oligomeric StateSize exclusion chromatographyElution profile consistent with theoretical molecular weightMultiple peaks may indicate aggregation or oligomerization
Membrane AssociationMembrane partitioning assayEnrichment in membrane fraction if predicted to be membrane-associatedImproper buffer conditions may affect membrane association
Functional AssessmentBased on predicted function (e.g., binding assays)Activity consistent with bioinformatic predictionsOptimization may be required if initial activity is low

These validation steps should be adapted based on the specific experimental goals and the evolving understanding of NGR_c32320's function .

What statistical approaches are most appropriate for analyzing experimental data involving NGR_c32320?

Selecting appropriate statistical methods for analyzing data from experiments with NGR_c32320 depends on the experimental design and the nature of the collected data. Here are guidelines for common experimental scenarios:

  • Comparing Experimental Groups: For experiments comparing the effect of NGR_c32320 across different conditions:

    • For normally distributed data: Use parametric tests such as t-tests (two groups) or ANOVA (multiple groups) followed by appropriate post-hoc tests

    • For non-normally distributed data: Use non-parametric alternatives such as Mann-Whitney U (two groups) or Kruskal-Wallis (multiple groups)

  • Time-Course Experiments: For experiments tracking changes over time:

    • Repeated measures ANOVA or mixed-effects models are appropriate

    • Consider time series analysis for complex temporal patterns

  • Dose-Response Studies: For experiments examining the relationship between NGR_c32320 concentration and a measured outcome:

    • Regression analysis (linear or non-linear depending on the relationship)

    • EC50/IC50 determination through appropriate curve fitting

  • Interaction Studies: For binding or interaction experiments:

    • Scatchard or Hill plot analysis for binding data

    • Appropriate model fitting for kinetic data (e.g., Michaelis-Menten for enzymatic interactions)

A typical statistical analysis workflow might include:

Analysis StepStatistical ApproachSoftware ToolsReporting Requirements
Data Normality TestingShapiro-Wilk or Kolmogorov-Smirnov testR, GraphPad Prism, SPSSReport test statistic and p-value
Outlier IdentificationGrubbs' test or box plot analysisR, GraphPad PrismDocument any excluded data points and justification
Group Comparisont-test/ANOVA or non-parametric equivalentR, GraphPad Prism, SPSSReport test statistic, degrees of freedom, p-value
Post-hoc TestingTukey's HSD, Bonferroni, or Dunnett's testR, GraphPad Prism, SPSSReport adjusted p-values for multiple comparisons
Effect Size CalculationCohen's d, η² (eta squared), or ω² (omega squared)R, SPSSReport alongside p-values to indicate practical significance

When designing experiments, power analysis should be conducted to determine appropriate sample sizes. For most biochemical assays with NGR_c32320, a minimum of three independent replicates is standard, though more may be required depending on the variability of the system and the size of the effect being measured .

How can NGR_c32320 be utilized in studies of rhizobial-plant symbiosis?

Rhizobium species are known for their ability to form symbiotic relationships with leguminous plants, facilitating nitrogen fixation. While the specific role of NGR_c32320 in this process remains under investigation, its potential membrane association suggests possible involvement in signaling or transport processes at the plant-microbe interface. Researchers can explore this using:

  • Gene Knockout/Knockdown Studies: Create NGR_c32320 deletion mutants in Rhizobium sp. and assess their ability to form effective nodules with host plants. Complementation studies with the recombinant protein can confirm phenotype specificity.

  • Localization During Symbiosis: Using fluorescently tagged versions of NGR_c32320, track its localization during different stages of nodule formation and nitrogen fixation.

  • Interactome Analysis: Identify plant proteins that interact with NGR_c32320 using the recombinant protein as bait in pull-down assays with plant root extracts.

A comprehensive experimental approach might include:

Research QuestionMethodologyControlsExpected Outcomes if Involved in Symbiosis
Is NGR_c32320 required for symbiosis?Gene deletion and nodulation assaysWild-type and complemented strainsReduced nodulation or nitrogen fixation in mutants
Where is NGR_c32320 localized during symbiosis?Confocal microscopy of fluorescently tagged proteinFree-living bacteria vs. nodule bacteriaRedistribution during infection thread formation or in bacteroids
What plant proteins interact with NGR_c32320?Pull-down assays with plant root extractsNon-host plant extracts, His-tag only controlsIdentification of plant receptors or signaling proteins
Is NGR_c32320 expression regulated during symbiosis?qRT-PCR at different stages of nodulationHousekeeping genes, genes known to be regulated during symbiosisDifferential expression patterns correlating with symbiotic stages

These studies would provide valuable insights into the potential role of NGR_c32320 in the complex process of rhizobial-plant symbiosis, potentially revealing new mechanisms in this agriculturally important interaction .

What recommendations would you suggest for researchers designing a comprehensive study of NGR_c32320 function?

For researchers embarking on a comprehensive investigation of NGR_c32320 function, a multi-faceted approach is recommended:

  • Bioinformatic Analysis: Begin with thorough sequence analysis, structure prediction, and comparative genomics to generate testable hypotheses about function. Look for conserved domains, sequence motifs, and similar proteins with known functions.

  • Expression Profiling: Determine under what conditions NGR_c32320 is expressed in Rhizobium sp., including different growth media, stress conditions, and symbiotic states.

  • Protein-Protein Interaction Network: Map the interactome of NGR_c32320 using complementary approaches (pull-downs, two-hybrid systems, crosslinking).

  • Genetic Manipulation: Create knockout, knockdown, and overexpression strains to assess phenotypic effects. Complement mutations with wild-type and mutant versions of the recombinant protein.

  • Structural Studies: Determine the three-dimensional structure using X-ray crystallography, NMR, or cryo-EM to provide insights into function.

  • Biochemical Characterization: Based on structural features and predictions, design assays to test potential biochemical activities.

A phased research plan might look like:

PhaseFocusKey MethodsExpected TimelineDecision Points
1: Initial CharacterizationBioinformatics and expression analysisSequence analysis, qRT-PCR, Western blotting3-6 monthsProceed based on expression patterns and predictions
2: Genetic AnalysisFunctional significance in vivoGene deletion, complementation, phenotyping6-12 monthsFocus subsequent biochemical work based on phenotypes
3: Protein Interaction StudiesIdentification of binding partnersPull-downs, two-hybrid screens, co-IP6-9 monthsSelect interaction partners for validation and further study
4: Structural BiologyThree-dimensional structureProtein purification optimization, crystallization, structure determination12-24 monthsUse structure to guide functional studies
5: Biochemical FunctionTesting of specific activitiesCustom assays based on predictions and results from phases 1-46-12 monthsRefine and validate functional models
6: IntegrationSynthesis of all data into functional modelSystems biology approaches, validation experiments3-6 monthsPublication and future directions

This phased approach allows for adjustment of research direction based on findings at each stage, ensuring efficient use of resources and maximizing the chances of successfully characterizing NGR_c32320's function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.