Recombinant Rhizobium sp. UPF0721 transmembrane protein y4hK (NGR_a03390)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice packaging, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
NGR_a03390; y4hK; Probable membrane transporter protein y4hK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Target Names
NGR_a03390
Target Protein Sequence
MDTEAIGLAIAFFVIALAYAAVGQAGASGYIAAMALSGFSPLAIKPTALALNLMVSAIGT AQFLKVGQVSWRNVYPFAILGFPASALGGSVHLPERVYHPVLGLILVVSAIQMARSALRK SALVITIPKTPPLHAALITGAVIGFVSGTTGSGGGVFLAPVILFKNWGTAHQTAATTAVY NLMNSTAALIGACASWNALPNFLPWWLIAVAAGGSIGALIGSRYLSASWLRVILSVLLMV SGLKLLW
Uniprot No.

Target Background

Database Links
Protein Families
4-toluene sulfonate uptake permease (TSUP) (TC 2.A.102) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is the UPF0721 protein family classified, and what is known about its function?

The UPF0721 protein family belongs to a group of uncharacterized protein families (UPF), indicating that its precise biological function remains to be fully elucidated. It is classified as a transmembrane protein based on its structural characteristics. While specific functions haven't been definitively established, structural analysis and sequence homology suggest potential roles in membrane transport or signaling pathways in Rhizobium species. The protein is encoded by the y4hK gene (also referred to by its ordered locus name NGR_a03390) in Rhizobium sp. strain NGR234 .

What are the optimal conditions for expressing recombinant UPF0721 transmembrane protein?

Expressing transmembrane proteins like UPF0721 presents significant challenges due to their hydrophobic nature. For optimal expression:

  • Expression System Selection:

    • Prokaryotic systems (e.g., E. coli) may be suitable for initial screening but often result in inclusion bodies

    • Eukaryotic systems (e.g., yeast or insect cells) often provide better membrane integration for transmembrane proteins

  • Expression Optimization:

    • Use lower incubation temperatures (16-25°C) to slow expression and improve folding

    • Consider codon optimization for the expression host

    • Employ fusion tags (e.g., MBP, SUMO) to enhance solubility

    • Use specialized E. coli strains designed for membrane protein expression (e.g., C41/C43 or Lemo21)

  • Induction Parameters:

    • Lower inducer concentrations (0.1-0.5 mM IPTG for E. coli)

    • Extended expression time (24-48 hours) at lower temperatures

Since transmembrane proteins can be toxic to expression hosts, controlled and slower expression rates often yield better results than maximizing protein quantity .

What are the most effective purification strategies for recombinant UPF0721 transmembrane protein?

Purification of transmembrane proteins requires specialized approaches:

  • Membrane Extraction:

    • Gentle cell lysis methods to preserve membrane integrity

    • Use of appropriate detergents (e.g., DDM, LDAO, or Triton X-100) to solubilize membrane proteins

    • Optimization of detergent concentration is critical to maintain protein structure

  • Purification Steps:

    • Affinity chromatography using appropriate tags (His-tag is common)

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for further purification

  • Considerations for UPF0721:

    • Store in Tris-based buffer with 50% glycerol as indicated in product specifications

    • Maintain at -20°C for short-term or -80°C for long-term storage

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

When using affinity chromatography, it's recommended to use fusion tags on both N and C termini to ensure purification of full-length protein and distinguish it from truncated products. Increasing imidazole concentration gradually during elution helps obtain the purest full-length protein fractions .

How can structural characterization of the UPF0721 transmembrane protein be approached?

Structural characterization of transmembrane proteins presents unique challenges due to their hydrophobic nature and membrane association. Multiple complementary approaches are recommended:

  • Computational Methods:

    • Sequence-based prediction of transmembrane helices

    • Homology modeling using related proteins with known structures

    • Molecular dynamics simulations in membrane environments

  • Experimental Techniques:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (increasingly useful for membrane proteins)

    • NMR spectroscopy for dynamic information

    • Limited proteolysis combined with mass spectrometry to identify domain boundaries

  • Biophysical Characterization:

    • Circular dichroism spectroscopy to assess secondary structure content

    • Fluorescence spectroscopy to probe conformational changes

    • Thermal shift assays to evaluate stability in different conditions

The UPF0721 transmembrane protein's multiple hydrophobic regions suggest a complex membrane topology that likely requires detergent micelles or lipid nanodiscs to maintain proper folding during structural studies .

What approaches can be used to assess the function of UPF0721 transmembrane protein?

Since UPF0721 is an uncharacterized protein family, functional assessment requires multiple lines of investigation:

  • Comparative Genomics:

    • Analysis of conservation patterns across Rhizobium species

    • Investigation of genomic context to identify potentially functionally related genes

    • Phylogenetic profiling to identify co-evolving protein families

  • Experimental Approaches:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Protein-protein interaction studies (co-immunoprecipitation, yeast two-hybrid)

    • Membrane localization studies using fluorescent protein fusions

    • Transport assays if a transport function is suspected

  • Expression Pattern Analysis:

    • qRT-PCR or RNA-seq to identify conditions that alter expression

    • Promoter reporter studies to understand regulation

Given the evolutionary conservation of this protein in Rhizobium species, comparative analysis across strains may provide insights into its importance for bacterial adaptation and survival in different environments .

How might recombination events affect the evolution of UPF0721 transmembrane protein across Rhizobium species?

Homologous recombination plays a significant role in the adaptive evolution of proteins in Rhizobium species:

  • Recombination Impact on Adaptive Evolution:

    • Research indicates that homologous recombination facilitates adaptive evolution in Rhizobium species, as measured by α (the proportion of amino acid substitutions fixed by adaptive evolution)

    • Across five closely related Rhizobium species, α values range from 0.07 to 0.39 and positively correlate with recombination levels

    • Higher recombination rates are associated with both higher rates of adaptive evolution (ωa) and lower rates of non-adaptive evolution (ωna)

  • Implications for UPF0721 Research:

    • Analysis of selection pressures on the y4hK gene across Rhizobium species could reveal whether this transmembrane protein is subject to purifying selection or adaptive evolution

    • Comparing recombination rates in genomic regions containing y4hK with the adaptive evolution rate could provide insights into how this protein evolves

    • Such analysis requires sequencing and comparative genomics of the gene across multiple Rhizobium isolates

  • Methodology for Studying Selection:

    • Calculate nucleotide diversity (π) and divergence in the y4hK gene

    • Apply McDonald-Kreitman tests to distinguish between neutral evolution and selection

    • Use site frequency spectrum (SFS) analysis to estimate the proportion of adaptive substitutions

This evolutionary perspective can provide insights into the functional importance of different domains within the protein and help identify regions under selection pressure .

What challenges are specific to expressing full-length transmembrane proteins like UPF0721, and how can they be addressed?

Expression of full-length transmembrane proteins presents several unique challenges:

  • Common Challenges:

    • Protein hydrophobicity leading to aggregation or misfolding

    • Toxicity to host cells during overexpression

    • Rare codon usage affecting translation efficiency

    • Improper membrane insertion leading to non-functional protein

    • Proteolytic degradation resulting in truncated products

  • Strategic Solutions:

    • Codon Optimization: Analyze the y4hK sequence for rare codons and optimize for the expression host

    • Expression Vectors: Use vectors with tightly regulated promoters to control expression levels

    • Host Selection: Choose specialized strains developed for membrane protein expression

    • Fusion Partners: Consider using fusion partners that enhance membrane targeting

    • Two-end Tagging: Implement N and C-terminal tags to ensure purification of full-length protein

  • Experimental Design Approach:

    • Use factorial design of experiments (DoE) to systematically optimize expression conditions

    • Test multiple variables simultaneously (temperature, inducer concentration, host strain, media composition)

    • Apply statistical analysis to identify significant factors affecting expression

    • Implement iterative optimization based on initial results

Table 1: Example DoE Matrix for Optimizing UPF0721 Expression

ExperimentTemperature (°C)IPTG (mM)Host StrainMedia TypeExpression LevelSoluble Fraction
1160.1BL21(DE3)LB++
2160.5C41(DE3)TB++++
3250.1C41(DE3)LB+++
4250.5BL21(DE3)TB+-
5370.1C41(DE3)TB+-
6370.5BL21(DE3)LB--

Expression level: (-) none, (+) low, (++) moderate, (+++) high
Soluble fraction: (-) none, (+) <25%, (++) 25-50%, (+++) >50%

How can aggregation issues during UPF0721 transmembrane protein purification be addressed?

Aggregation is a common challenge when working with transmembrane proteins like UPF0721:

  • Prevention Strategies:

    • Optimize detergent selection: Test a panel of detergents (non-ionic, zwitterionic, and mild ionic) at various concentrations

    • Include stabilizing additives: Glycerol (10-20%), specific lipids, or cholesterol analogs can enhance stability

    • Maintain low protein concentration during initial extraction

    • Keep samples cold throughout purification process

    • Avoid conditions that strip away essential lipids

  • Rescue Approaches for Aggregated Protein:

    • Screening detergent mixtures may solubilize aggregates better than single detergents

    • Gradual detergent exchange through dialysis or on-column methods

    • Addition of specific lipids that may be required for stability

    • Test different buffer compositions (pH, salt concentration, additives)

  • Analytical Methods to Monitor Aggregation:

    • Dynamic light scattering to assess particle size distribution

    • Size-exclusion chromatography to separate monomeric protein from aggregates

    • Analytical ultracentrifugation to determine oligomeric states

    • Blue native PAGE to analyze native protein complexes

For UPF0721 specifically, the storage recommendations in 50% glycerol suggest this additive helps maintain stability, and this concentration could be reduced gradually during experimental procedures to prevent aggregation .

What are the best approaches for validating the proper folding and functionality of recombinant UPF0721 transmembrane protein?

Validating proper folding and functionality of transmembrane proteins requires multiple complementary approaches:

  • Structural Integrity Assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Intrinsic tryptophan fluorescence to monitor tertiary structure

    • Limited proteolysis patterns compared to native protein

    • Thermal stability assays (differential scanning fluorimetry)

  • Functional Validation Strategies:

    • Reconstitution into liposomes or nanodiscs to mimic native membrane environment

    • Binding assays if interaction partners are known

    • Activity assays based on predicted function (e.g., transport assays)

    • Complementation studies in knockout strains

  • Comparative Analysis:

    • Side-by-side comparison with native protein extracted from Rhizobium sp.

    • Cross-validation using different expression systems and purification methods

For UPF0721 specifically, since its function is not well-characterized, structural integrity assessment becomes particularly important. Additionally, comparative studies across different Rhizobium species may provide insights into conserved functional properties .

How does the UPF0721 transmembrane protein contribute to Rhizobium's symbiotic relationships with legumes?

The potential role of UPF0721 transmembrane protein in Rhizobium-legume symbiosis remains an active area of research:

  • Theoretical Context:

    • Rhizobium sp. strain NGR234 is known for its broad host range, capable of nodulating with over 112 genera of legumes

    • Transmembrane proteins often function in signaling, recognition, and transport processes critical for host-microbe interactions

    • The y4hK gene is found in the core genome of Rhizobium species, suggesting potential importance for fundamental bacterial functions

  • Research Approaches:

    • Knockout studies of y4hK gene to assess impact on nodulation efficiency

    • Expression analysis during different stages of symbiotic relationship

    • Localization studies during infection thread formation and nodule development

    • Protein-protein interaction studies with plant receptor proteins

    • Comparative genomics across Rhizobium strains with different host specificities

  • Methodological Recommendations:

    • Generate y4hK mutants using CRISPR-Cas or transposon mutagenesis

    • Perform plant infection assays comparing wild-type and mutant strains

    • Use transcriptomics and proteomics to identify expression patterns during symbiosis

    • Apply fluorescent tagging to track protein localization during infection process

Understanding the role of UPF0721 in symbiosis could provide insights into the molecular mechanisms underlying Rhizobium's remarkable host range and adaptation to different legume partners .

What bioinformatic approaches are most effective for predicting protein-protein interactions involving UPF0721 transmembrane protein?

Predicting protein-protein interactions (PPIs) for transmembrane proteins like UPF0721 requires specialized approaches:

  • Sequence-Based Methods:

    • Co-evolution analysis to identify potentially interacting proteins

    • Domain-based interaction prediction using conserved motifs

    • Primary sequence-based machine learning approaches trained on known membrane protein interactions

    • Analysis of membrane topology to identify potential interaction interfaces

  • Structure-Based Approaches:

    • Homology modeling followed by protein-protein docking

    • Threading and ab initio modeling combined with interaction surface analysis

    • Molecular dynamics simulations in membrane environments

  • Integrated Prediction Pipeline:

    • Combine multiple predictive methods for higher confidence

    • Incorporate species-specific information about Rhizobium biology

    • Filter predictions based on subcellular localization and expression patterns

    • Validate top predictions experimentally using targeted approaches

  • Experimental Validation Strategies:

    • Bacterial two-hybrid systems adapted for membrane proteins

    • Co-immunoprecipitation with crosslinking for transient interactions

    • FRET/BRET assays to detect interactions in living cells

    • Proximity labeling methods (BioID, APEX) to identify neighboring proteins

The integration of computational predictions with targeted experimental validation provides the most robust approach for discovering the interaction network of poorly characterized proteins like UPF0721 .

How should researchers interpret evolutionary conservation patterns of UPF0721 across Rhizobium species?

Analyzing evolutionary conservation patterns provides valuable insights into protein function and importance:

  • Methodological Approach:

    • Collect y4hK gene sequences from multiple Rhizobium species and strains

    • Perform multiple sequence alignment (MSA) to identify conserved regions

    • Calculate site-specific evolutionary rates (dN/dS ratios) to detect selection pressure

    • Map conservation onto predicted structural models

  • Interpretation Framework:

    • Highly Conserved Regions: Likely crucial for core protein function; may represent active sites or structural determinants

    • Variable Regions: May indicate adaptation to specific environments or hosts

    • Selection Signatures: Positive selection (dN/dS > 1) suggests adaptive evolution, while purifying selection (dN/dS < 1) indicates functional constraint

  • Integration with Adaptive Evolution Research:

    • Consider the impact of recombination on the evolution of y4hK

    • Compare the proportion of adaptive substitutions (α) in y4hK to the genomic background

    • Analyze whether y4hK evolution correlates with host range or environmental adaptations

Understanding these patterns can guide experimental design by highlighting the most functionally important regions of the protein for targeted mutagenesis or functional characterization .

What are the most relevant controls and validation steps when studying UPF0721 transmembrane protein function?

Robust experimental design for studying UPF0721 function requires comprehensive controls and validation:

  • Essential Controls:

    • Positive Controls: Well-characterized transmembrane proteins with similar properties

    • Negative Controls: Non-functional mutants or unrelated transmembrane proteins

    • Expression Controls: Verification of proper expression levels and localization

    • Host Background Controls: Studies in both wild-type and knockout backgrounds

  • Validation Hierarchy:

    • Independent Methods: Confirm findings using multiple experimental approaches

    • Complementation Studies: Rescue phenotypes by reintroducing wild-type protein

    • Domain Analysis: Structure-function studies through targeted mutations

    • Cross-Species Validation: Test orthologous proteins from related Rhizobium species

  • Statistical Considerations:

    • Ensure sufficient biological and technical replicates

    • Use appropriate statistical tests based on data distribution

    • Control for multiple testing when screening multiple conditions

    • Consider effect sizes in addition to statistical significance

  • Reproducibility Framework:

    • Detailed documentation of experimental conditions

    • Standardization of protein preparation and assay conditions

    • Independent validation across different laboratories when possible

    • Publication of negative results to avoid publication bias

Implementing these controls and validation steps will enhance the reliability of functional characterization studies and facilitate integration with existing knowledge about Rhizobium proteins .

What emerging technologies show promise for advancing the study of transmembrane proteins like UPF0721?

Several cutting-edge technologies are transforming transmembrane protein research:

  • Structural Biology Advances:

    • AlphaFold2 and RoseTTAFold: AI-based structure prediction showing unprecedented accuracy for transmembrane proteins

    • Cryo-EM: Continued advances in resolution now enabling atomic models of membrane proteins without crystallization

    • Integrative Structural Biology: Combining multiple data sources (SAXS, NMR, crosslinking-MS) for complete structural models

  • Functional Characterization:

    • CRISPR-Cas Systems: Precise genome editing in Rhizobium for in vivo functional studies

    • Nanopore Technology: Single-molecule analysis of transmembrane protein function

    • Microfluidics: High-throughput screening of conditions for optimal protein stability and function

  • Interaction Analysis:

    • Native Mass Spectrometry: Analysis of intact membrane protein complexes

    • In-cell NMR: Study protein dynamics in near-native conditions

    • Single-molecule FRET: Probe conformational changes and interactions

  • Computational Approaches:

    • Molecular Dynamics: Enhanced sampling methods for membrane protein simulations

    • Quantum Mechanics/Molecular Mechanics (QM/MM): Study reaction mechanisms at atomic detail

    • Network Biology: Systems-level analysis of protein function in cellular context

These technologies, especially when used in combination, promise to accelerate understanding of challenging proteins like UPF0721 transmembrane protein .

How might understanding UPF0721 transmembrane protein contribute to broader knowledge about prokaryotic membrane biology?

Studying UPF0721 has implications beyond this specific protein:

  • Conceptual Contributions:

    • Insights into evolution and adaptation of bacterial transmembrane proteins

    • Understanding of how membrane protein diversity contributes to species-specific traits

    • Knowledge about uncharacterized protein families that may represent novel functional classes

  • Methodological Advances:

    • Development of optimized protocols for expressing and studying transmembrane proteins

    • Refinement of computational tools for predicting membrane protein structures and functions

    • Establishment of new experimental paradigms for characterizing proteins of unknown function

  • Biological Significance:

    • Potential discovery of novel membrane-associated processes in bacteria

    • Better understanding of how core membrane proteins contribute to basic cellular functions

    • Insights into membrane adaptations that enable specific ecological niches or symbiotic relationships

  • Translational Potential:

    • Possible identification of new targets for antibacterial development

    • Discovery of proteins that could be engineered for biotechnological applications

    • Understanding of bacterial adaptations that might be harnessed for agricultural improvements

Research on UPF0721 contributes to filling knowledge gaps in prokaryotic membrane biology, particularly regarding proteins that may perform essential but currently unrecognized functions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.