Recombinant Rhizopus oryzae FK506-binding protein 2A (FKBP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FKBP2; fpr2; RO3G_06709; FK506-binding protein 2A; Peptidyl-prolyl cis-trans isomerase; PPIase; Rotamase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-167
Protein Length
Full Length of Mature Protein
Species
Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar)
Target Names
FKBP2
Target Protein Sequence
AKSESTINKPEKCGLKASSSSTVRIHYRSRVWGQEEYFESTYIREAPLEVKLGNGNLLKG IEDGIHGMCTGEIRRLLIPPNQAYGAIGIPNLVPPNTAIVVDVEMVNVNSPFSLWFWISG LILFSAFLLFGRKPIKGDTSNIKKKE
Uniprot No.

Target Background

Function
PPIases accelerate protein folding by catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Protein Families
FKBP-type PPIase family, FKBP2 subfamily
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What expression systems are used for Recombinant Rhizopus oryzae FKBP2 production?

E. coli is the predominant expression system for recombinant FKBP2 production from Rhizopus oryzae. The protein is commonly expressed as a full-length mature protein (residues 22-167) fused to an N-terminal His-tag to facilitate purification. This bacterial expression system provides high yields of functional protein that can be readily purified using affinity chromatography techniques .

What are the optimal storage conditions for Recombinant Rhizopus oryzae FKBP2?

The optimal storage conditions for Recombinant Rhizopus oryzae FKBP2 include:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For long-term storage, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is recommended) before storing at -20°C/-80°C

What is the biological significance of Rhizopus oryzae in research contexts?

Rhizopus oryzae is the most extensively studied member of the Rhizopus genus and has significant research importance in both basic science and industrial applications. As a saprophytic fungus, it is found in decaying organic matter and has been utilized for:

  • Traditional food production, particularly tempeh, a fermented soybean product consumed in Southeast Asia since the 15th century

  • Industrial production of organic acids, especially L-lactic acid and fumaric acid

  • Enzyme production for various biotechnological applications

In research contexts, R. oryzae serves as a model organism for studying fungal molecular biology, protein expression systems, and enzyme production capabilities.

What experimental methodologies are most effective for studying FKBP2 prolyl isomerase activity?

The most effective methodologies for studying FKBP2 prolyl isomerase activity include:

  • NMR-based approaches:

    • 15N and 2H relaxation experiments can be performed at different magnetic field strengths to evaluate changes in subnanosecond intramolecular dynamics of backbone and methyl-bearing side chains

    • These measurements provide order parameters that quantify the restriction of motion for specific bonds within the protein

  • Molecular Dynamics (MD) simulations:

    • MD simulations validated against experimental order parameters can extract conformational entropy information

    • This approach allows visualization of protein dynamics at atomic resolution

  • Functional assays with model substrates:

    • Using proline-containing peptides to measure cis-trans isomerization rates

    • Coupling isomerization to detectable signals (fluorescence or absorbance changes)

  • Cellular assays with physiological substrates:

    • In the case of proteins like FKBP2 that may participate in folding of specific substrates (analogous to how mammalian FKBP2 assists proinsulin folding), knockout/knockdown studies can reveal functional consequences

    • Analysis of substrate folding efficiency, half-life, and structural properties in the presence and absence of FKBP2

How can researchers effectively analyze FKBP2 interactions with potential binding partners?

Researchers can effectively analyze FKBP2 interactions with potential binding partners using:

  • Fluorescence Polarization (FP) assays:

    • Allow quantification of binding interactions in solution

    • Can determine IC50 values for inhibitor compounds or binding affinities for natural partners

  • Differential Scanning Calorimetry (DSC):

    • Measures thermal shifts upon ligand binding

    • Particularly useful for identifying covalent interactions, as these produce larger thermal shifts compared to non-covalent interactions

  • Co-immunoprecipitation followed by mass spectrometry:

    • Identifies physiologically relevant binding partners in cellular contexts

    • Similar to approaches used to identify mammalian FKBP2 interactions with chaperones like GRP94

  • Surface Plasmon Resonance (SPR):

    • Provides real-time binding kinetics

    • Can determine association and dissociation rate constants

  • Structural biology approaches:

    • X-ray crystallography of FKBP2-ligand complexes

    • Cryo-EM for larger complexes with binding partners

For data analysis, researchers should consider using multiple complementary techniques and performing appropriate controls to distinguish specific from non-specific interactions.

What are the critical factors for successful expression and purification of Recombinant Rhizopus oryzae FKBP2?

Successful expression and purification of Recombinant Rhizopus oryzae FKBP2 depends on several critical factors:

  • Expression system optimization:

    • E. coli is the preferred expression host for R. oryzae FKBP2

    • Optimal codon optimization for E. coli expression

    • Careful selection of expression vector and promoter strength

    • Induction conditions (temperature, IPTG concentration, duration)

  • Purification strategy:

    • N-terminal His-tag facilitates purification using immobilized metal affinity chromatography (IMAC)

    • Appropriate buffer composition during purification (Tris/PBS-based buffers at pH 8.0 work well)

    • Addition of protease inhibitors to prevent degradation

    • Consider size exclusion chromatography as a polishing step

  • Quality control assessments:

    • SDS-PAGE to confirm purity (>90% purity is achievable)

    • Mass spectrometry to verify correct molecular weight and sequence

    • Activity assays to confirm functional integrity

  • Reconstitution and storage considerations:

    • Brief centrifugation prior to opening lyophilized protein vials

    • Reconstitution in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of glycerol (5-50%) for long-term storage

    • Aliquoting to avoid repeated freeze-thaw cycles

How can researchers distinguish between FKBP2-mediated effects and non-specific interactions in experimental systems?

Distinguishing FKBP2-mediated effects from non-specific interactions requires rigorous control experiments:

  • Catalytically inactive mutants:

    • Generate point mutations in the active site of FKBP2

    • Compare effects of wild-type vs. mutant protein in assays

    • Preserved binding but eliminated catalytic activity indicates specific enzymatic effects

  • Competitive inhibition studies:

    • Use known FKBP inhibitors (e.g., FK506 or rapamycin analogs)

    • Dose-dependent reversal of effects suggests specific FKBP2 involvement

    • Controls should include structurally similar but non-inhibitory compounds

  • Knockout/knockdown validation:

    • Generate FKBP2 knockout systems (analogous to the FKBP2 KO cells used in proinsulin folding studies)

    • Rescue experiments with wild-type protein should restore phenotypes

    • Partial rescue with catalytically inactive mutants helps distinguish scaffolding from enzymatic functions

  • Substrate specificity analysis:

    • Compare effects on multiple potential substrates

    • Identify structural features that correlate with FKBP2 sensitivity

    • Analyze substrates with mutated proline residues to confirm direct targeting

What methodological approaches can resolve conflicting data in FKBP2 research?

When confronted with conflicting data in FKBP2 research, the following methodological approaches can help resolve discrepancies:

  • Standardization of experimental conditions:

    • Carefully control temperature, pH, buffer composition, and protein concentrations

    • Document detailed protocols to enable reproducibility

    • Use the same protein preparation methods across comparative studies

  • Multi-technique validation:

    • Apply orthogonal techniques to verify observations

    • For example, complement binding studies with both biophysical (SPR, ITC) and cellular approaches

    • Use both in vitro and in vivo systems to validate findings

  • Careful consideration of protein state:

    • Assess protein quality before experiments (aggregation state, thermal stability)

    • Consider effects of tags and fusion partners on protein function

    • Verify proper folding using circular dichroism or fluorescence spectroscopy

  • Biological context assessment:

    • Consider differences between in vitro and cellular environments

    • Evaluate the presence of competing binding partners or substrates

    • Account for post-translational modifications that might affect function

  • Statistical rigor and reproducibility:

    • Perform adequate biological and technical replicates

    • Apply appropriate statistical tests to determine significance

    • Consider blinded experimental design when applicable

How can Rhizopus oryzae FKBP2 be applied in protein folding studies?

Rhizopus oryzae FKBP2 can be applied in protein folding studies through several innovative approaches:

  • Comparative folding catalyst systems:

    • Fungal FKBP2 can serve as a comparative model to mammalian PPIases

    • Studies can investigate substrate specificities across evolutionary distant PPIases

    • This may reveal fundamental principles of proline isomerization in protein folding

  • Industrial protein production applications:

    • Co-expression of R. oryzae FKBP2 might enhance folding of difficult-to-express proteins

    • This approach could leverage the potentially unique substrate preferences of fungal FKBP2

    • Particularly valuable for proteins with critical proline residues that limit folding efficiency

  • Model system development:

    • Drawing from studies of mammalian FKBP2's role in proinsulin folding, researchers could develop analogous systems using R. oryzae FKBP2

    • Investigate whether fungal FKBP2 exhibits specific preferential binding to unfolded, reduced proteins similar to mammalian FKBP2's preference for unfolded proinsulin

  • Structural biology applications:

    • R. oryzae FKBP2 could be used as a crystallization chaperone for challenging proteins

    • The prolyl isomerase activity might stabilize specific conformations of target proteins

What are promising research directions for developing FKBP2-targeted compounds?

Promising research directions for developing FKBP2-targeted compounds include:

  • Structure-guided design approaches:

    • Using structural data to design specific inhibitors or modulators

    • Development of compounds that can distinguish between different FKBP family members

    • Focus on creating compounds with improved solubility profiles, as demonstrated in Series 2 compounds where addition of a free carboxylate to compound 2c (generating 2h) reduced cLogP from 4.4 to 3.5 while improving PBS solubility from <0.1 μM to 70 μM

  • Covalent inhibitor development:

    • Design of targeted covalent inhibitors similar to those developed for Plasmodium FKBP35

    • Incorporation of Michael acceptors to form stable covalent complexes with target residues

    • Monitoring formation of covalent bonds using thermal shift assays in differential scanning calorimetry

  • Species-selective compounds:

    • Development of compounds that selectively target fungal FKBPs over human homologs

    • This approach could lead to novel antifungal strategies

    • Targeting species-specific binding pocket features

  • Allosteric modulators:

    • Design compounds targeting allosteric sites rather than the active site

    • This approach may offer greater selectivity between FKBP family members

    • May provide tools to modulate rather than completely inhibit FKBP2 function

How might changes in intramolecular dynamics inform FKBP2 functional studies?

Changes in intramolecular dynamics can provide crucial insights into FKBP2 function through:

  • Conformational entropy considerations:

    • NMR studies measuring backbone and methyl-axis order parameters can quantify changes in conformational entropy upon ligand binding

    • This approach, similar to that used for FKBP12-FK506 interactions, can reveal thermodynamic components of binding not evident from structure alone

  • Allosteric communication pathways:

    • Analysis of dynamical changes across the protein structure can reveal networks of residues involved in transmitting conformational changes

    • This information helps identify functionally important residues beyond the active site

    • May guide mutagenesis studies to validate computational predictions

  • Substrate selectivity mechanisms:

    • Dynamics may explain substrate preferences that aren't obvious from static structures

    • Differences in flexibility between apo and substrate-bound states can reveal induced-fit mechanisms

    • Comparative dynamics between different FKBP family members may explain functional divergence

  • Experimental design guidelines:

    • Understanding protein dynamics guides the design of more informative experimental approaches

    • Helps identify appropriate timeframes for kinetic measurements

    • Informs the selection of probe positions for fluorescence or spin-labeling studies

TechniqueInformation ObtainedTimescaleAdvantagesLimitations
NMR RelaxationOrder parameters, conformational entropyps-nsSite-specific information, quantitativeRequires isotope labeling, size limitations
Molecular DynamicsAtomic motions, energy landscapesfs-μsComplete spatial and temporal resolutionForce field limitations, sampling challenges
Hydrogen-Deuterium ExchangeSolvent accessibility, conformational fluctuationsms-hrsWorks with large proteins, no labeling requiredLimited spatial resolution
Single-molecule FRETLarge-scale conformational changesμs-sDirect observation of rare eventsRequires fluorescent labeling

How does Rhizopus oryzae FKBP2 compare to FKBP homologs in other organisms?

Rhizopus oryzae FKBP2 belongs to the broader family of FK506-binding proteins found across all kingdoms of life. Cross-species comparisons reveal:

  • Functional conservation:

    • The core peptidyl-prolyl cis-trans isomerase (PPIase) function is preserved across species

    • FKBP2 proteins generally participate in protein folding processes, though with species-specific substrate preferences

    • In mammals, FKBP2 participates in proinsulin folding and is induced during ER stress responses

  • Structural variations:

    • While maintaining core structural elements, FKBPs from different species show variations in binding pocket architecture

    • These differences can be exploited for species-selective inhibitor development

    • For example, studies on Plasmodium FKBP35 show that unlike the human homolog, it cannot accommodate aryl rings within the binding pocket

  • Subcellular localization:

    • Mammalian FKBP2 is localized to the endoplasmic reticulum where it assists in protein folding

    • The precise subcellular localization of R. oryzae FKBP2 requires further investigation, though sequence analysis suggests potential membrane association

  • Evolutionary adaptations:

    • Different organisms have evolved specific features in their FKBP proteins that reflect their particular cellular environments and requirements

    • The fungal FKBP2 may have specialized to handle the unique proteome of filamentous fungi

What can we learn from comparative studies of FKBP2 across fungal species?

Comparative studies of FKBP2 across fungal species can provide valuable insights:

  • Functional specialization:

    • Different fungal species may have evolved specialized roles for their FKBP2 proteins

    • Rhizopus oryzae, as a filamentous fungus used in food fermentation, may have FKBP2 adaptations related to its ecological niche and metabolism

    • Comparative analysis could reveal how FKBP2 function correlates with fungal lifestyle (saprophytic, pathogenic, symbiotic)

  • Structure-function relationships:

    • Comparing FKBP2 proteins from related fungal species can highlight conserved vs. variable regions

    • Conserved regions likely maintain core catalytic functions

    • Variable regions may indicate adaptation to species-specific substrates or cellular environments

  • Biotechnological applications:

    • Identification of fungal FKBP2 variants with unique properties could lead to novel biotechnological tools

    • Some variants might offer advantages for specific protein folding applications

    • Different fungal FKBP2 proteins might exhibit varying stability under industrial conditions

  • Evolutionary insights:

    • Phylogenetic analysis of FKBP2 across fungal species can trace the evolutionary history of this protein family

    • This may reveal horizontal gene transfer events or convergent evolution

    • Could help understand the evolutionary pressures that shaped modern fungal PPIases

What are the most significant knowledge gaps in Rhizopus oryzae FKBP2 research?

Despite progress in understanding FK506-binding proteins, several significant knowledge gaps remain in Rhizopus oryzae FKBP2 research:

  • Natural substrate identification:

    • The physiological substrates of R. oryzae FKBP2 remain largely unknown

    • Understanding which proteins depend on FKBP2 for proper folding in Rhizopus would provide crucial functional insights

    • Methodologies similar to those used to identify proinsulin as a substrate for mammalian FKBP2 could be applied

  • Regulatory mechanisms:

    • How FKBP2 expression and activity are regulated in Rhizopus oryzae is poorly understood

    • Investigation into whether R. oryzae FKBP2 is induced during stress conditions, similar to mammalian FKBP2 induction during ER stress

    • Potential post-translational modifications that might regulate activity

  • Structural determinants of specificity:

    • Detailed structural studies specifically on R. oryzae FKBP2 are lacking

    • Understanding the unique structural features that distinguish it from mammalian homologs

    • Crystal structures of R. oryzae FKBP2 in complex with natural substrates or inhibitors

  • Role in fungal physiology and development:

    • The consequences of FKBP2 deficiency or overexpression on R. oryzae growth, development, and stress responses

    • Potential involvement in cellular processes beyond protein folding

What emerging technologies could advance Rhizopus oryzae FKBP2 research?

Several emerging technologies hold promise for advancing Rhizopus oryzae FKBP2 research:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of FKBP2 in complex with larger protein partners

    • Can capture different conformational states without crystallization

    • May reveal dynamic aspects of FKBP2 function

  • Integrative structural biology approaches:

    • Combining NMR, X-ray crystallography, and computational modeling

    • Provides complementary structural and dynamic information

    • Can reveal functional mechanisms not apparent from any single method

  • Genome editing in fungi:

    • CRISPR-Cas9 technologies optimized for filamentous fungi

    • Enables precise genetic manipulation of FKBP2 in its native context

    • Facilitates investigation of physiological roles and substrate specificities

  • Proteomics and interactomics:

    • Advanced mass spectrometry techniques to identify binding partners and substrates

    • Proximity labeling approaches to capture transient interactions

    • Quantitative proteomics to assess global effects of FKBP2 manipulation

  • Computational approaches:

    • Advanced molecular dynamics simulations with enhanced sampling

    • Machine learning for prediction of FKBP2 substrates based on sequence and structural features

    • Systems biology modeling of FKBP2 in protein folding networks

These emerging technologies, combined with established approaches, will drive significant advances in understanding the structure, function, and applications of Rhizopus oryzae FKBP2 in coming years.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.