Recombinant Rhizopus stolonifer Cytochrome c oxidase subunit 3 (COX3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

COX3 is one of three core subunits (COX1, COX2, COX3) of cytochrome c oxidase encoded by mitochondrial DNA in eukaryotes . In Rhizopus stolonifer, a filamentous fungus, COX3 is essential for:

  • Stabilizing the structural integrity of Complex IV .

  • Facilitating electron transfer from cytochrome c to molecular oxygen .

  • Maintaining proton translocation efficiency, though its direct role in proton pumping remains debated .

The recombinant form is produced in E. coli to enable biochemical and functional studies .

Production and Purification

Key details from the recombinant protein’s datasheet :

ParameterSpecification
Expression SystemE. coli with polyhistidine or HA tags.
Purity>85% (SDS-PAGE verified).
Storage-20°C/-80°C (lyophilized form stable for 12 months).
ReconstitutionRequires deionized water; glycerol (5–50%) recommended for long-term stability.

Functional Insights from Research

  • Assembly Role: In yeast, COX3 forms a module with nuclear-encoded subunits (Cox4p, Cox7p, Cox13p) during Complex IV assembly .

  • Proton Translocation: Mutagenesis studies in bacteria suggest COX3 is not essential for proton pumping, but its absence reduces enzyme stability .

  • Interactions: COX3 interacts with accessory proteins like Rcf1p, which stabilizes supercomplexes (e.g., COX-bc1 complexes) .

Research Applications

The recombinant COX3 is utilized for:

  • Enzyme Kinetics: Studying electron transfer efficiency in fungal respiration.

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve Complex IV architecture .

  • Pathogenicity Studies: Investigating mitochondrial dysfunction in Rhizopus-related infections.

Comparative Analysis with Other Species

OrganismCOX3 FeaturesReference
Homo sapiens (MT-CO3)261 amino acids; linked to mitochondrial disorders (e.g., Leber optic neuropathy) .
Paracoccus denitrificans274 residues; forms part of bacterial oxidase core .
Rhizopus stoloniferPartial recombinant protein; optimized for in vitro studies .

Outstanding Questions

  • Does Rhizopus COX3 require specific chaperones for assembly, as seen in yeast ?

  • How do post-translational modifications affect its function in fungal metabolism?

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time details.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate this to us in advance and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us and we will prioritize developing the specified tag.
Synonyms
COX3; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Rhizopus stolonifer (Rhizopus nigricans)
Target Names
COX3
Target Protein Sequence
MIEMYDRNYIYNMTTKIMNRSVQAHPFHLVEASPWPIAVSFSLLVVTLSGVMTFQGYSNG LFLLTLGFISLVSTMTLWFKDISREGTFQGHHTFAVQKGLSLGFVLFVVSEVFFFISIFW AFFHSALAPTVELGAHWPPAGIETLNPWEVPLLNTVILLSSGATVTYAHHANPSNRAGVI YGLIATIVLATVFTGFQGFEYYNAPFTFSDGVYGSTFYMATGFHGIHVLVGTIFLTVGLF RVLSYHLTDHHHLGFEQAILYWHFVDVVWLFLFISVYWWGG
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (COX3) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes collaborate to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane. This gradient drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Rhizopus stolonifer and why is it significant for biochemical research?

Rhizopus stolonifer is a widespread fungal pathogen responsible for significant postharvest losses in fruits including strawberries, tomatoes, and melons. This organism accounts for approximately 80% of losses from Rhizopus rot in tomato fruits . From a biochemical perspective, R. stolonifer plays an important ecological role in the carbon cycle by decomposing organic matter and recycling nutrients like starch and sugar .

The significance for research stems from:

  • Its rapid growth characteristics making it an efficient model organism

  • Its ability to produce extracellular enzymes that break down complex substrates

  • Its pathogenicity mechanisms that involve complex biochemical interactions

  • Its metabolic adaptation capabilities under various environmental conditions

Understanding the cellular respiration components of this organism, including Cytochrome c oxidase subunit 3, provides insights into how this fungus maintains its aggressive growth patterns during infection.

What is the structural and functional role of Cytochrome c oxidase subunit 3 in cellular metabolism?

Cytochrome c oxidase (CcO) functions as the terminal electron acceptor in the electron transport chain, with subunit III (COX3) serving as one of the core components of this enzyme complex. While COX3 contains no redox centers itself, it plays several crucial structural and functional roles :

  • It contributes to maintaining proper proton uptake pathways, particularly the D-pathway

  • It prevents suicide inactivation, extending the catalytic lifespan of CcO by up to 600-fold

  • It binds phospholipids in highly conserved binding sites that contribute to protein-protein interactions

  • It helps regulate the rate of proton uptake at different pH levels

The removal of subunit III from CcO has been shown to make proton uptake into the D pathway a rate-determining step and dramatically reduces the catalytic lifespan of the enzyme . This structural support function is critical for maintaining efficient electron transfer and proton pumping during cellular respiration.

What detection methods are available for studying Rhizopus stolonifer in laboratory settings?

Multiple detection methods have been developed for R. stolonifer identification, each with specific advantages for research applications:

MethodDetection TimeAccuracyKey AdvantagesLimitations
Traditional culturing (PDA)24-48 hoursHighSimple, widely availableSlow, requires expertise
Hyperspectral imagingMinutes to hours97.5%Rapid, non-destructiveExpensive equipment
Spectral detectionHours78%Sensitive for conidiaComplex data analysis
RGB image transformationMinutesVariableAccessible technologyRequires machine learning
Nanocomposite electrochemicalMinutesHighHighly sensitive, portableNew technology, limited validation
Raman spectroscopyMinutesHighDetailed molecular informationExpensive equipment

Recent developments include a copper and tin-codoped mesoporous BaTiO3-G-SiO2 nanocomposite that provides sensitive electrochemical detection of R. stolonifer in food samples . This approach allows for detection without bioreceptors and is significantly less expensive than enzyme assays, making it potentially valuable for agricultural and research applications .

How can researchers effectively express and purify recombinant COX3 from Rhizopus stolonifer?

Expressing and purifying recombinant membrane proteins like COX3 requires specialized approaches:

  • Expression system selection:

    • Eukaryotic systems (yeast, insect cells) are preferable for membrane proteins

    • Codon optimization for the host organism is essential

    • Expression temperature should be lowered (16-20°C) to improve folding

  • Purification strategy:

    • Gentle solubilization with appropriate detergents (DDM, LMNG)

    • Inclusion of specific phospholipids during purification is critical

    • Two-phase purification combining affinity chromatography followed by size exclusion

  • Key considerations for COX3:

    • The relatively weak association of subunit III with subunit I necessitates careful buffer optimization

    • Maintenance of bound phospholipids is essential for structural integrity

    • Reconstitution into proteoliposomes may be necessary for functional studies

What experimental approaches can assess the functional integrity of recombinant COX3?

Several complementary experimental approaches can verify functional integrity:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Limited proteolysis to assess proper folding

    • Native PAGE to evaluate complex formation

  • Biochemical assays:

    • Lipid binding assays (as COX3 binds specific phospholipids)

    • pH-dependent activity measurements to assess proton uptake functionality

    • Catalytic lifespan measurements under turnover conditions

  • Specific functional parameters to monitor:

ParameterExperimental ApproachExpected Outcome for Functional COX3
Proton uptake ratepH-sensitive dye measurementspH-dependent with apparent pKa ~8.6 when in complex
F→O transition kineticsTime-resolved spectroscopyNormal rate at physiological pH
Catalytic lifespanExtended turnover measurements600-fold longer than COX3-depleted enzyme
Lipid bindingFluorescence or mass spectrometrySpecific binding of conserved phospholipids

The pH dependence of activity provides particularly valuable information, as research shows that removal of subunit III shifts the apparent pKa from ~8.6 to ~7, indicating altered proton uptake dynamics .

How does removal of COX3 affect the proton transfer mechanisms in Cytochrome c oxidase?

The removal of COX3 significantly impacts proton transfer through the D-pathway, with several measurable effects :

  • Altered pH dependence:

    • The apparent pKa of the F→O transition shifts from ~8.6 to ~7

    • Proton uptake becomes rate-limiting at pH values above 7

    • Normal activity is restored at lower pH (5.5)

  • Structural basis for altered function:

    • COX3 contributes to forming the environment around Asp-132, the initial proton acceptor

    • Without COX3, the exposure of Asp-132 to bulk solvent is altered

    • Half of the residues lining the "well" that leads to Asp-132 come from subunit III

  • Functional consequences:

    • Slower proton uptake at physiological pH

    • Increased probability of suicide inactivation

    • Potential reduction in proton pumping efficiency

These effects highlight how COX3, though not directly involved in the catalytic mechanism, plays a crucial structural role in maintaining proper proton transfer pathways. The data suggest that COX3 helps position Asp-132 for optimal proton capture from the bulk solvent, thereby ensuring efficient enzyme function .

What mechanisms contribute to suicide inactivation in the absence of COX3?

Suicide inactivation represents a catastrophic event leading to irreversible enzyme inactivation. Research has identified several key aspects of this process :

  • Primary molecular event:

    • Loss of CuB from the heme a3-CuB active site

    • Observable in both bacterial and mammalian COX when subunit III is removed

  • Correlation with proton uptake:

    • Slow proton uptake promotes suicide inactivation

    • Conditions that improve proton uptake reduce the probability of inactivation

  • Preventive role of COX3:

    • Extends catalytic lifespan by 600-fold or more

    • Maintains proper conformation of the proton uptake pathway

    • May regulate access of potential damaging species to the active site

  • Experimental evidence:

    • The pH dependence of the F→O transition correlates with inactivation probability

    • Single catalytic cycle experiments show impaired proton uptake prior to inactivation

This phenomenon is not restricted to bacterial oxidases; removal of subunit III leads to similar inactivation in rat liver and bovine heart CcO during turnover . This evolutionary conservation suggests that preventing premature loss of this major energy-conserving enzyme complex may explain why subunit III is as well conserved as the core catalytic subunit I.

How can researchers distinguish between functional effects specific to R. stolonifer COX3 versus general COX3 properties?

To distinguish R. stolonifer-specific effects from general COX3 properties, researchers should implement a comprehensive comparative approach:

  • Controlled comparative studies:

    • Express and purify COX3 from multiple species using identical methods

    • Compare functional parameters under standardized conditions

    • Use chimeric proteins with domains swapped between species

  • Experimental design considerations:

    • Use identical buffers, pH, and temperature across experiments

    • Maintain consistent protein:lipid ratios in reconstitution studies

    • Implement paired statistical analyses for direct comparisons

  • Specific experimental approaches:

ParameterExperimental MethodControl Comparison
Proton uptake kineticspH-sensitive dye measurementsCompare with model organism COX3 (yeast, bovine)
Temperature stabilityThermal shift assaysTest across physiologically relevant range
Catalytic lifespanSuicide inactivation measurementsCompare inactivation rates under identical conditions
pH dependenceActivity measurements across pH rangeCompare apparent pKa values

When interpreting results, researchers should consider R. stolonifer's ecological niche and rapid growth characteristics, which might be reflected in adaptations of its respiratory chain components for efficient energy production under varying conditions .

How might understanding R. stolonifer COX3 contribute to developing novel antifungal strategies?

COX3 research provides several potential avenues for antifungal development:

  • Target identification:

    • Species-specific features of R. stolonifer COX3 could be exploited

    • Targeting the interaction between subunits I and III might selectively disrupt fungal respiration

    • Compounds that promote suicide inactivation could be effective and selective

  • Potential intervention strategies:

    • Molecules that disrupt phospholipid binding to COX3

    • Compounds that alter the proton uptake pathway specifically in fungal COX

    • Agents that accelerate inactivation during rapid growth phases

  • Methodological approaches:

    • Structure-based drug design targeting R. stolonifer-specific regions

    • High-throughput screening for compounds that selectively disrupt fungal COX function

    • Development of delivery systems targeting germinating spores

Understanding the molecular basis of R. stolonifer's rapid growth and infection mechanisms, particularly energy generation through respiration, provides potential targets for intervention that could help reduce the 80% losses in tomato crops attributed to this pathogen .

What techniques can researchers use to study the interaction between R. stolonifer infection and host fruit metabolism?

Studying the interface between pathogen respiration and host metabolism requires integrative approaches:

  • Metabolomic analysis:

    • Compare metabolite profiles in infected vs. healthy tissue

    • Track changes in respiratory intermediates during infection progression

    • Identify potential metabolic signatures of COX function alteration

  • Transcriptomic approaches:

    • Monitor expression of both host and pathogen respiratory genes

    • Track COX3 expression patterns during different infection stages

    • Identify regulatory networks controlling respiratory adaptation

  • Imaging techniques:

    • Hyperspectral imaging can detect early stages of fungal infection

    • Correlate spectral changes with biochemical alterations in host tissue

    • Monitor the spatial spread of infection relative to metabolic changes

  • Experimental considerations:

Stage of InfectionKey Parameters to MonitorTechniques
Early (0-12h)Spore germination, initial respirationSpectroscopy, oxygen consumption
Intermediate (12-36h)Rapid mycelial growth, peak respirationTranscriptomics, metabolomics
Advanced (36-48h)Complete colonization, tissue breakdownImaging, enzymatic assays

Research indicates that R. stolonifer grows extremely rapidly, fully colonizing culture media within 36-48 hours . This rapid growth correlates with high respiratory activity, making the cytochrome c oxidase complex a significant factor in the infection process.

What are the most promising directions for structural biology investigations of fungal COX3?

Several cutting-edge structural biology approaches offer potential for deeper understanding:

  • Cryo-electron microscopy (cryo-EM):

    • Most promising for intact membrane protein complexes

    • Can resolve lipid-protein interactions critical for COX3 function

    • Enables visualization of conformational states during catalysis

  • Integrative structural biology:

    • Combining multiple techniques (X-ray crystallography, NMR, HDX-MS)

    • Computational modeling incorporating experimental constraints

    • Molecular dynamics simulations of proton transfer pathways

  • Specific research questions addressable by structural biology:

    • How does the structure of R. stolonifer COX3 compare to other species?

    • What structural features explain the rapid growth phenotype?

    • How do bound phospholipids influence the conformation of the D-pathway?

  • Technical considerations for fungal COX3:

    • Sample preparation is critical due to the weak association between subunits

    • Lipid composition must be carefully controlled during purification

    • Time-resolved methods may capture transient conformational states

Understanding the structural basis of COX3 function would help explain how this subunit extends catalytic lifespan by 600-fold and maintains proper proton uptake pathways, potentially revealing fungal-specific features that could be exploited for selective targeting .

What are the critical parameters for maintaining functional integrity of recombinant R. stolonifer COX3 during purification?

Several factors critically affect COX3 functional integrity:

  • Detergent selection:

    • Mild detergents (DDM, LMNG) preserve lipid-protein interactions

    • Detergent concentration must remain above CMC throughout purification

    • Gradual detergent exchange may be necessary for optimal stability

  • Buffer optimization:

    • pH should be maintained near physiological levels (pH 7.2-7.5)

    • Ionic strength affects subunit association strength

    • Glycerol (10-15%) helps prevent aggregation

  • Critical additives:

AdditiveRecommended ConcentrationFunction
Specific phospholipids0.01-0.05 mg/mLMaintain native binding sites
Glycerol10-15%Prevent aggregation
Reducing agent1-5 mM DTT or TCEPPrevent oxidative damage
Protease inhibitorsManufacturer recommendedPrevent degradation
  • Temperature considerations:

    • Maintain 4°C throughout purification

    • Avoid freeze-thaw cycles

    • For storage, flash-freeze in liquid nitrogen in small aliquots

Research indicates that the weak association between subunit III and the rest of the complex requires particular attention to maintain the intact enzyme . The phospholipid binding sites in COX3 are essential for its stabilizing function, making lipid retention during purification crucial for functional studies.

How can researchers verify successful expression of functional recombinant R. stolonifer COX3?

Verification requires a multi-faceted approach:

  • Protein identity confirmation:

    • Western blotting with specific antibodies

    • Mass spectrometry peptide mapping

    • N-terminal sequencing

  • Functional verification:

    • pH-dependent activity measurements (F→O transition)

    • Catalytic lifespan determination

    • Proton uptake capability

  • Structural integrity assessment:

    • Circular dichroism to verify secondary structure

    • Blue native PAGE to assess complex formation

    • Thermal stability measurements

  • Comparison with reference standards:

ParameterExpected Result for Functional COX3Indication of Problems
Apparent pKa~8.6 in complex, ~7 for isolated COX3Altered proton uptake properties
Catalytic lifespanExtended compared to COX3-depleted enzymeCompromised structural integrity
Phospholipid bindingSpecific binding of conserved lipidsImproper folding or detergent damage
Thermal stabilityTm consistent with reference proteinDestabilized structure

Researchers should be particularly mindful that most bacterial aa3-type CcOs preparations contain substochiometric amounts of subunit III due to its weak binding . Quantification of subunit III content is important for experimental reproducibility and proper interpretation of results.

What are the key takeaways for researchers working with recombinant R. stolonifer COX3?

Several fundamental principles should guide research on R. stolonifer COX3:

  • Structural considerations:

    • COX3 plays a crucial structural role despite lacking redox centers

    • The weak association between COX3 and the rest of the complex requires careful handling

    • Phospholipid binding is essential for proper function

  • Functional importance:

    • COX3 extends catalytic lifespan by 600-fold or more

    • It maintains proper proton uptake pathways, particularly at physiological pH

    • Its removal makes proton uptake rate-limiting at pH values above 7

  • Methodological approaches:

    • Expression systems must be carefully selected for membrane proteins

    • Purification protocols should preserve lipid-protein interactions

    • Functional assays should include pH dependence and catalytic lifespan

  • Research applications:

    • Understanding R. stolonifer metabolism may lead to better control strategies

    • The rapid growth phenotype correlates with high respiratory demands

    • Targeting fungal-specific features of COX3 could lead to selective interventions

The available evidence indicates that COX3 serves as a critical structural component that maintains the functional integrity of cytochrome c oxidase, particularly under the demanding conditions of rapid fungal growth and host colonization .

What emerging technologies show promise for advancing R. stolonifer COX3 research?

Several cutting-edge technologies offer significant potential:

  • Advanced structural methods:

    • Cryo-EM for membrane protein complexes

    • Time-resolved spectroscopy for capturing functional states

    • Single-molecule techniques for observing dynamic processes

  • Genetic and molecular tools:

    • CRISPR-Cas9 for precise genome editing in R. stolonifer

    • Optogenetic approaches for controlling protein function

    • Cell-free expression systems for rapid protein production

  • Detection and monitoring systems:

    • Nanocomposite-based sensors for detecting fungal presence

    • Hyperspectral imaging for non-destructive monitoring

    • Label-free detection methods for protein-protein interactions

  • Computational approaches:

    • Molecular dynamics simulations of proton transfer

    • Machine learning for predicting functional consequences of sequence variations

    • Systems biology modeling of respiratory chain function

Recent developments in nanocomposite-based electrochemical detection show particular promise, offering sensitive, quick, and bioreceptor-free detection methods that could transform both research applications and practical monitoring of R. stolonifer .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.