Recombinant Rhodobacter capsulatus ATP synthase protein I (atpI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in your order notes, and we will do our best to fulfill your needs.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference point.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase protein I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-114
Protein Length
full length protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
atpI
Target Protein Sequence
MSEEVGGEPDPERLAALEKRLSQLKKTEEAPKRAADGDLRMADMAWRMVIELVSGLGIGF GIGYGLDAVFGTQPFLMLIFVFLGLAAGVKVMLRSAADLTKAQARAAAAGKEGK
Uniprot No.

Target Background

Function
A possible function of this protein is to guide the assembly of the membrane sector of the ATPase enzyme complex.
Protein Families
Bacterial AtpI family
Subcellular Location
Cellular chromatophore membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase protein I (atpI) in Rhodobacter capsulatus?

ATP synthase protein I (atpI) is a membrane-associated component of the ATP synthase complex in Rhodobacter capsulatus. The full-length protein consists of 114 amino acids with the sequence: MSEEVGGEPDPERLAALEKRLSQLKKTEEAPKRAADGDLRMADMAWRMVIELVSGLGIGFGIGYGLDAVFGTQPFLMLIFVFLGLAAGVKVMLRSAADLTKAQARAAAAGKEGK . The protein functions as part of the membrane-embedded F0 sector of the ATP synthase, which works in conjunction with the catalytic F1 sector to generate ATP through a rotary mechanism.

The ATP synthase complex in R. capsulatus, like in other organisms, acts as a molecular motor that couples the transmembrane proton motive force to the synthesis of ATP from ADP and inorganic phosphate. During ATP synthesis, the central rotor turns approximately 150 times per second, converting the energy stored in the electrochemical gradient into chemical energy in the form of ATP . The atpI protein specifically contributes to the proton-conducting pathway that facilitates this energy conversion process.

Unlike many other bacterial species, R. capsulatus has its ATP synthase genes organized into separate operons, with the F0 and F1 sectors encoded by distinct genetic clusters. While the F1 sector genes (atpHAGDC) have been thoroughly characterized , the F0 sector genes, including atpI, are located elsewhere on the chromosome.

How does R. capsulatus ATP synthase differ from those in other organisms?

R. capsulatus ATP synthase exhibits several distinctive features compared to ATP synthases from other organisms. First, the gene organization in R. capsulatus is unusual, with the F0 and F1 components encoded by separate operons located in different regions of the chromosome . This arrangement is similar to that found in close relatives like Rhodospirillum rubrum and Rhodopseudomonas blastica, but differs from many other bacteria where all ATP synthase components are encoded in a single operon.

Another notable difference is that ATP synthase appears to be essential for viability in R. capsulatus under all tested growth conditions, as researchers were unable to isolate viable cells with ATP synthase deletions . This contrasts with some other bacterial species where ATP synthase is dispensable under certain growth conditions.

The R. capsulatus ATP synthase also exhibits unique regulatory properties, including light-induced proton slip, which has been thoroughly documented in experiments with R. capsulatus chromatophores . This feature makes the R. capsulatus system particularly valuable for studying the enzyme's proton-conducting properties and regulatory mechanisms.

What are the advantages of using R. capsulatus chromatophores for ATP synthase research?

R. capsulatus chromatophores represent an exceptionally valuable experimental system for investigating ATP synthase function for several key reasons. First, these membrane vesicles enable stepped generation of proton motive force (pmf) jumps through simple light excitation with short flashes, providing precise temporal control over energization . This feature allows researchers to initiate ATP synthesis with exceptional timing accuracy and reproducibility.

Second, the R. capsulatus system offers convenient read-out methods for monitoring both voltage changes and pH gradients across the membrane. This is accomplished through absorption band-shifts of intrinsic carotenoids (electrochromism) for voltage measurements and added pH indicators for pH gradient assessment . These spectroscopic techniques provide real-time, non-invasive monitoring of the energetic parameters driving ATP synthesis.

Third, and perhaps most valuable for mechanistic studies, is the single-enzyme-per-vesicle characteristic of R. capsulatus chromatophores. Due to their small size, these vesicles typically contain less than one copy of FOF1-ATP synthase per vesicle on average . This property enables statistical analysis of single-enzyme behavior, which has been exploited to determine fundamental parameters such as the proton conductance of the FO sector after removal of the F1 component.

Finally, the photosynthetic nature of R. capsulatus allows researchers to study ATP synthase under physiologically relevant conditions, as light-driven electron transport generates the proton gradient that powers ATP synthesis in vivo. This provides insights into how the enzyme functions within its natural energetic context.

What methods are available for purifying recombinant R. capsulatus atpI protein for structural and functional studies?

Purification of recombinant R. capsulatus atpI protein requires specialized techniques due to its membrane-associated nature. The process typically begins with recombinant expression in a suitable host system, followed by a multi-step purification protocol. The recombinant protein is typically stored in a Tris-based buffer containing 50% glycerol to maintain stability .

For structural and functional studies, researchers should be aware that the atpI protein contains hydrophobic transmembrane regions that require careful handling. The amino acid sequence (MSEEVGGEPDPERLAALEKRLSQLKKTEEAPKRAADGDLRMADMAWRMVIELVSGLGIGFGIGYGLDAVFGTQPFLMLIFVFLGLAAGVKVMLRSAADLTKAQARAAAAGKEGK) includes multiple hydrophobic stretches typical of membrane proteins .

When designing purification protocols, it is essential to maintain protein stability through appropriate detergent selection for solubilization. Common detergents for ATP synthase subunit purification include n-dodecyl-β-D-maltoside (DDM) or digitonin, which effectively solubilize membrane proteins while preserving their native conformation.

For long-term storage, the purified protein should be stored at -20°C, with extended storage preferably at -80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be maintained at 4°C for up to one week to minimize degradation . These careful handling procedures are critical for maintaining the structural integrity and functional properties of the protein for subsequent experiments.

How can R. capsulatus ATP synthase be used as a model for investigating rotary mechanisms in molecular motors?

The R. capsulatus ATP synthase represents an excellent model system for investigating the fundamental principles of rotary molecular motors. Researchers can exploit the unique properties of R. capsulatus chromatophores, particularly the ability to precisely control energization through light pulses . This allows for time-resolved studies of rotor movement and catalytic events with exceptional temporal resolution.

To investigate rotary mechanisms, researchers typically employ a combination of techniques. Single-molecule fluorescence resonance energy transfer (FRET) can be used to track the rotational movement of specific labeled subunits during catalysis. This involves strategic placement of fluorescent probes on the rotor and stator components, allowing real-time observation of conformational changes during ATP synthesis or hydrolysis.

Another powerful approach utilizes the light-dependent properties of R. capsulatus to initiate rotation and then monitor subsequent events. For example, researchers can apply short light flashes to generate a defined proton motive force, then use rapid kinetic techniques to follow the resulting catalytic events. This approach has revealed that during ATP synthesis, the central rotor turns approximately 150 times per second, converting the electrochemical gradient energy into ATP .

The chromatophore system also enables detailed analysis of how proton translocation couples to rotary motion. By manipulating the magnitude of the proton motive force through varying light intensity, researchers can establish the energetic thresholds required for rotation and explore the efficiency of energy conversion. This has provided insights into how the proton-conducting pathway in the membrane-embedded FO sector mechanically drives the rotation of the central stalk.

What approaches can be used to study the proton slip phenomenon in R. capsulatus ATP synthase?

Proton slip, a phenomenon where protons translocate through ATP synthase without coupling to ATP synthesis, can be systematically investigated using R. capsulatus chromatophores. This system is particularly advantageous because proton slip can be induced by continuous illumination , providing a controlled experimental paradigm.

To study this phenomenon, researchers typically employ a combination of spectroscopic and biochemical approaches. The experimental design often includes the following elements:

  • Membrane potential measurements: Using carotenoid electrochromism as an intrinsic probe, researchers can monitor membrane potential changes that accompany proton translocation. This spectroscopic technique allows real-time, non-invasive assessment of how proton slip affects the maintenance of membrane potential.

  • pH gradient monitoring: By incorporating pH-sensitive dyes that exhibit absorption shifts with changing pH, researchers can track the dissipation of the pH gradient across the membrane during proton slip events.

  • ATP synthesis assays: Concurrent measurement of ATP synthesis rates using luciferin-luciferase bioluminescence assays enables quantification of how proton slip affects the coupling efficiency between proton translocation and ATP production.

  • Light intensity modulation: By varying the intensity of illumination, researchers can control the rate of proton slip induction, establishing dose-response relationships and threshold effects.

A typical experimental approach involves comparing samples under different conditions: one sample illuminated in the absence of nucleotides (to induce slip) and another kept in the dark as a control . Both samples are then analyzed for changes in proton conductance, ATP synthesis capability, and potential structural alterations.

These studies have revealed that continuous illumination induces proton slip without causing detachment of the F1 portion from the FO sector, as confirmed by centrifugation experiments and SDS-PAGE analysis of supernatants . This indicates that proton slip represents a functional alteration rather than a structural disassembly of the complex.

What methods are available for introducing mutations into the R. capsulatus ATP synthase genes?

Introducing mutations into the R. capsulatus ATP synthase genes presents unique challenges because these genes appear to be essential for cell viability under standard growth conditions . Researchers have developed specialized approaches to overcome this limitation.

A particularly effective method combines gene transfer agent (GTA) transduction with conjugation . This approach enables the construction of strains carrying mutations in indispensable genes like those of the ATP synthase. The process typically follows these steps:

  • Creation of a mutation in a plasmid copy: First, the desired mutation is introduced into a plasmid-borne copy of the ATP synthase gene using standard molecular biology techniques such as site-directed mutagenesis.

  • Complementation system establishment: A complementation system is constructed where the mutated gene can be expressed in trans while the chromosomal copy is targeted for deletion.

  • GTA transduction and conjugation: The gene transfer agent (GTA) system, which is a phage-like particle produced by R. capsulatus that transfers random ~4.5 kb fragments of chromosomal DNA, is used in combination with conjugative plasmid transfer to introduce the complementing copy and deletion construct.

  • Selection of transconjugants: Appropriate antibiotic resistance markers are used to select for cells that have integrated the deletion construct while maintaining the complementing plasmid.

This approach has successfully circumvented the lethality of ATP synthase mutations, opening avenues for detailed structure-function studies . The promoter region of the atpHAGDC operon has been well-defined through primer extension analysis, facilitating the design of expression constructs with appropriate regulatory elements .

How can researchers analyze the expression and assembly of recombinant R. capsulatus ATP synthase components?

Analysis of the expression and assembly of recombinant R. capsulatus ATP synthase components requires a multi-faceted approach that combines molecular biology, biochemistry, and biophysical techniques. Given the complex multi-subunit nature of ATP synthase and its membrane association, specialized methods are necessary.

For expression analysis, researchers typically employ the following techniques:

  • Quantitative RT-PCR: This method enables precise quantification of transcript levels for specific ATP synthase genes, providing insights into transcriptional regulation under different growth conditions or in response to genetic manipulations.

  • Western blotting: Using antibodies specific to individual ATP synthase subunits, researchers can quantify protein expression levels and assess post-translational modifications. This technique can be particularly informative when comparing wild-type and mutant strains.

  • Pulse-chase experiments: By briefly labeling newly synthesized proteins with radioactive amino acids and then "chasing" with non-radioactive amino acids, researchers can track the synthesis, assembly, and turnover of ATP synthase components.

Assembly analysis is more complex and often involves these approaches:

  • Blue Native PAGE: This technique separates membrane protein complexes in their native state, allowing visualization of assembled ATP synthase complexes and sub-complexes.

  • Sucrose gradient centrifugation: This method separates protein complexes based on size and density, enabling isolation of fully assembled ATP synthase from intermediate assembly states.

  • Functional reconstitution: Purified components can be reconstituted into liposomes to assess whether they assemble into functional complexes capable of ATP synthesis or hydrolysis.

  • Chromatophore preparation and analysis: For in vivo studies, chromatophores can be isolated from R. capsulatus cells expressing recombinant ATP synthase components. These vesicles can then be analyzed for ATP synthase content (estimated at one ATP synthase per 1000 bacteriochlorophylls) and enzymatic activity.

When analyzing assembly, researchers must consider that the F0 and F1 sectors of R. capsulatus ATP synthase are encoded by separate operons , which may affect the coordination of their expression and assembly. Additionally, amino-terminal processing of ATP synthase subunits has been documented , requiring careful consideration when designing detection methods.

How do specific amino acid residues in atpI contribute to proton translocation in R. capsulatus ATP synthase?

The atpI protein in R. capsulatus ATP synthase contains critical amino acid residues that facilitate proton translocation across the membrane. The full protein sequence (MSEEVGGEPDPERLAALEKRLSQLKKTEEAPKRAADGDLRMADMAWRMVIELVSGLGIGFGIGYGLDAVFGTQPFLMLIFVFLGLAAGVKVMLRSAADLTKAQARAAAAGKEGK) includes several hydrophobic segments that form transmembrane helices, interspersed with more hydrophilic regions.

Structure-function analysis reveals that the transmembrane domains contain specific residues that contribute to proton channeling. Particularly important are polar residues located within the hydrophobic transmembrane regions, which can form hydrogen bonds with water molecules or other polar amino acids to create a proton-conducting pathway. The glycine-rich segments (GLGIGFGIGYGLDAVFGT and GLAAGVKV) provide structural flexibility that may be important for conformational changes during proton translocation .

The contribution of specific residues to proton translocation can be investigated using site-directed mutagenesis combined with functional assays. For example, substitution of polar residues within the transmembrane domains typically results in altered proton conductance, which can be measured using the light-induced proton translocation assays in chromatophores . These experiments have demonstrated that even conservative substitutions can significantly impact proton translocation efficiency.

What structural features of R. capsulatus ATP synthase contribute to its regulation by light?

R. capsulatus ATP synthase exhibits distinctive regulatory responses to light, particularly the phenomenon of light-induced proton slip . This unique regulatory feature arises from specialized structural elements within the ATP synthase complex that have evolved to optimize energy conversion in a photosynthetic organism.

The light regulation of R. capsulatus ATP synthase involves several structural components:

  • Sensor domains: The ATP synthase complex contains elements that directly or indirectly respond to changes in the cellular redox state caused by photosynthetic electron transport. These sensor regions undergo conformational changes in response to light-induced alterations in membrane potential or redox carriers.

  • Regulatory interfaces: The interface between the FO and F1 sectors serves as a critical regulatory junction. Light-induced changes can alter the coupling efficiency at this interface, potentially through modifications in protein-protein interactions or subtle conformational shifts.

  • Proton-conducting pathway: The structure of the proton channel within the FO sector, to which atpI contributes, contains specific residues that may undergo light-dependent conformational changes. These alterations can modify the proton conductance properties of the channel, affecting the efficiency of energy coupling.

  • Allosteric regulation sites: The ATP synthase complex contains allosteric sites that bind regulatory molecules whose concentrations change in response to light. For example, alterations in the ATP/ADP ratio or other metabolites during light-dark transitions may affect ATP synthase function through binding to these sites.

Experimental approaches to studying these structural features include spectroscopic methods that can detect conformational changes in real-time following light exposure. For instance, researchers have observed that continuous illumination induces proton slip without causing detachment of the F1 portion from the FO sector , suggesting specific conformational changes rather than gross structural alterations.

Understanding these light-responsive structural elements has significant implications for bioenergetics research and the development of light-controlled molecular machines. The natural light-regulation mechanisms in R. capsulatus ATP synthase provide inspiration for designing synthetic energy-converting systems with controllable efficiency.

How does R. capsulatus ATP synthase compare with ATP synthases from other bacterial species in terms of structure and function?

Sequence comparisons reveal high conservation with other photosynthetic bacteria, particularly in the catalytic subunits. The β and α subunits of R. capsulatus show 89% and 86% sequence identity, respectively, with those from Rhodopseudomonas blastica, and 79% and 74% identity with Rhodospirillum rubrum . The homology with non-photosynthetic bacteria is lower but still substantial, with 69% and 55% identity with the corresponding E. coli subunits .

Functionally, a notable distinction of R. capsulatus ATP synthase is its essentiality under all tested growth conditions. Researchers were unable to obtain viable cells carrying ATP synthase deletions, indicating that these genes are indispensable . This contrasts with some other bacterial species where ATP synthase can be dispensable under certain conditions.

The regulatory properties also differ between species. R. capsulatus ATP synthase exhibits light-induced proton slip , a regulatory mechanism particularly suited to a photosynthetic lifestyle. This allows the enzyme to respond to changing light conditions by adjusting its coupling efficiency, a feature not prominent in non-photosynthetic bacteria.

Structurally, the R. capsulatus ATP synthase contains additional open reading frames (ORFs) near the ATP synthase operon that show homology to those found in Rhodopseudomonas blastica . This suggests conservation of regulatory or structural elements among photosynthetic bacteria that are absent in other bacterial lineages.

What insights can comparative studies of ATP synthases provide for developing new antimicrobial strategies?

Comparative studies of ATP synthases from different bacterial species, including R. capsulatus, provide valuable insights for antimicrobial drug development. The essential nature of ATP synthase in many bacterial pathogens, coupled with structural and functional differences between bacterial and human enzymes, makes it an attractive target for selective inhibition.

Research has identified "significant and largely unexplored differences between the structures of the human and bacterial enzymes and how their activities are regulated" . These structural and regulatory distinctions can be exploited to develop compounds that selectively inhibit bacterial ATP synthases while sparing the human enzyme.

ATP synthase is already an established clinical target for treating tuberculosis , demonstrating the feasibility of this approach. By expanding comparative studies to include diverse bacterial species like R. capsulatus, researchers can identify conserved bacterial-specific features that could serve as targets for broad-spectrum antibiotics, as well as species-specific features for narrow-spectrum agents.

The rotary mechanism of ATP synthase offers multiple potential inhibition sites:

  • The proton-conducting channel: Compounds that block proton translocation through the F0 sector would prevent ATP synthesis. The structure of this channel differs sufficiently between bacterial and human enzymes to allow selective targeting.

  • The rotor-stator interface: Molecules that interfere with the rotational mechanism by binding at the interface between rotating and stationary components could specifically inhibit bacterial enzymes.

  • Regulatory sites: The unique regulatory mechanisms of bacterial ATP synthases, such as the light-induced proton slip in R. capsulatus , may involve regulatory binding sites that are absent in the human enzyme.

  • Assembly pathways: Differences in ATP synthase assembly between bacteria and humans could be exploited by developing compounds that interfere with bacterial-specific assembly processes.

Detailed structural and functional characterization of R. capsulatus ATP synthase contributes to this comparative framework, helping identify both conserved bacterial features and unique adaptations related to photosynthetic energy conversion. These insights can guide the rational design of new antimicrobial compounds targeting ATP synthase, addressing the critical need for novel antibiotics to combat multidrug-resistant organisms .

How can R. capsulatus ATP synthase be used to study the principles of bioenergetic coupling?

R. capsulatus ATP synthase serves as an exceptional model system for investigating the fundamental principles of bioenergetic coupling—the conversion between different forms of cellular energy. The photosynthetic nature of R. capsulatus provides unique experimental advantages for studying how light energy is ultimately converted to chemical energy in the form of ATP.

The R. capsulatus chromatophore system allows precise control over energization through light exposure. Researchers can use short flashes of light to generate stepped increases in proton motive force (pmf) , enabling detailed kinetic analysis of how changes in pmf correlate with ATP synthesis rates. This approach has revealed the threshold pmf required for ATP synthesis and the efficiency of energy conversion under various conditions.

One particularly valuable aspect of this system is the ability to independently manipulate the two components of pmf: the electrical potential (ΔΨ) and the pH gradient (ΔpH). By using ionophores that selectively dissipate either component, researchers can determine their relative contributions to driving ATP synthesis. This has provided insights into the bioenergetic principles governing energy transduction in membrane systems.

The phenomenon of proton slip in R. capsulatus ATP synthase also offers a unique window into the mechanisms of energy coupling and uncoupling . Studies of how continuous illumination induces proton slip without causing structural dissociation of the F0 and F1 sectors have revealed regulatory mechanisms that modulate coupling efficiency in response to physiological conditions.

Furthermore, the small size of R. capsulatus chromatophores, which typically contain less than one ATP synthase per vesicle , enables statistical analysis of single-enzyme behavior. This has allowed researchers to determine intrinsic parameters such as the number of protons required per ATP synthesized and the conductance of individual proton channels.

What role does the ATP synthase play in maintaining cellular energy homeostasis in R. capsulatus?

ATP synthase plays a central role in maintaining energy homeostasis in R. capsulatus, functioning as the primary converter of light-generated proton motive force into ATP. This role is so crucial that ATP synthase appears to be essential for viability in R. capsulatus under all tested growth conditions , highlighting its irreplaceable function in cellular energetics.

In photosynthetic growth conditions, light energy captured by the photosynthetic apparatus drives electron transport, which pumps protons across the membrane to generate a proton motive force. The ATP synthase harnesses this force to synthesize ATP, completing the light-to-chemical energy conversion pathway. This ATP then powers various cellular processes, including biosynthesis, transport, and motility.

The ATP synthase also contributes to pH homeostasis by coupling proton translocation to ATP synthesis. When excess protons accumulate due to intense photosynthetic activity, ATP synthase increases its activity to utilize this gradient, thereby preventing excessive acidification of the cellular interior. Conversely, under conditions where the proton gradient is limiting, the enzyme can adjust its coupling efficiency through regulatory mechanisms like proton slip to maintain critical cellular ATP levels.

The genomic organization of ATP synthase genes into separate operons for the F0 and F1 sectors may reflect evolutionary adaptations for fine-tuning expression levels of different components under varying environmental conditions. This arrangement potentially allows for differential regulation of proton translocation (F0) and catalytic (F1) capacities to optimize energy conservation under changing light conditions.

What are the most promising areas for future research on R. capsulatus ATP synthase?

Research on R. capsulatus ATP synthase continues to evolve, with several promising directions that could yield significant scientific and practical advances. Key areas for future investigation include:

  • High-resolution structural studies: While significant progress has been made in understanding the genetic organization and function of R. capsulatus ATP synthase, high-resolution structural data remains limited. Applying cryo-electron microscopy and X-ray crystallography to obtain detailed structures of the complete R. capsulatus ATP synthase complex would provide invaluable insights into its unique regulatory mechanisms, particularly the structural basis of light-induced proton slip .

  • Single-molecule biophysics: The R. capsulatus chromatophore system, with its unique property of containing approximately one ATP synthase per vesicle , provides an ideal platform for advancing single-molecule studies. Development of new fluorescent probes and high-sensitivity detection methods could enable real-time observation of rotary catalysis in individual enzyme molecules, revealing mechanistic details that are obscured in ensemble measurements.

  • Synthetic biology applications: The light-responsive properties of R. capsulatus ATP synthase could be harnessed for developing light-controlled bioenergetic systems. Engineering modified versions of the enzyme with enhanced or altered light sensitivity could lead to novel biotechnological applications, such as light-driven ATP production systems for cell-free metabolic engineering.

  • Comparative genomics and evolution: Expanding comparative studies between R. capsulatus and other bacterial species could illuminate the evolutionary adaptations that have shaped ATP synthase structure and function in different environments. Particular attention to the separate operon organization of F0 and F1 genes might reveal regulatory advantages of this arrangement in photosynthetic bacteria.

  • Integration with whole-cell metabolism: Systems biology approaches could explore how ATP synthase activity is coordinated with other metabolic pathways in R. capsulatus. This would involve developing comprehensive metabolic models that incorporate the dynamic regulation of ATP synthase in response to changing light conditions and energy demands.

  • Antimicrobial applications: Further characterization of the structural and functional differences between R. capsulatus and human ATP synthases could contribute to the development of new antibiotics that selectively target bacterial ATP synthases . The photosynthetic bacterial model provides additional comparative information that could reveal bacterial-specific features amenable to therapeutic targeting.

How might advances in structural biology techniques enhance our understanding of R. capsulatus ATP synthase?

Advances in structural biology techniques promise to revolutionize our understanding of R. capsulatus ATP synthase, providing unprecedented insights into its molecular architecture and dynamic behavior. These methodological innovations will address fundamental questions that have remained elusive with conventional approaches.

Cryo-electron microscopy (cryo-EM) has undergone remarkable improvements in resolution and sample preparation, now enabling near-atomic resolution structures of membrane protein complexes. Applied to R. capsulatus ATP synthase, cryo-EM could reveal the detailed arrangement of subunits within the complete F0F1 complex and capture different conformational states associated with the catalytic cycle. This would be particularly valuable for understanding the structural basis of light-induced regulatory mechanisms like proton slip .

Time-resolved structural methods, including time-resolved X-ray crystallography and time-resolved cryo-EM, offer the exciting possibility of visualizing structural changes as they occur during catalysis. For R. capsulatus ATP synthase, these techniques could be synchronized with light pulses to capture the transient conformational states that occur during light-activated ATP synthesis, providing a molecular movie of the enzyme in action.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map protein dynamics and solvent accessibility across the entire ATP synthase complex. This approach would be particularly valuable for identifying regions of the protein that undergo conformational changes during proton translocation or in response to light activation, complementing static structural information with dynamic insights.

Integrative structural biology approaches that combine multiple techniques (X-ray crystallography, cryo-EM, nuclear magnetic resonance, cross-linking mass spectrometry, etc.) with computational modeling would provide the most comprehensive view of R. capsulatus ATP synthase structure. These methods could address challenges such as resolving the structure of the membrane-embedded F0 sector, which has traditionally been difficult to characterize due to its hydrophobicity.

Advanced labeling techniques for electron paramagnetic resonance (EPR) spectroscopy could measure distances between specific residues during different functional states, providing critical information about conformational changes that occur during rotary catalysis. This would be particularly valuable for understanding how the unique features of R. capsulatus ATP synthase contribute to its specific functional properties in a photosynthetic context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.