Recombinant Rhodobacter capsulatus ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-185
Protein Length
Full Length of Mature Protein
Species
Rhodobacter capsulatus (Rhodopseudomonas capsulata)
Target Names
atpF
Target Protein Sequence
EGPFVSLRNAHFVILVAFLIFVGVLIKFKVPSMLLGMLDKRAEGIKADLDEAKALRDEAQ KILASYERKAREVQGQADEIVAAAKRDAQLAAEQAKADLKEAIARRLKGAEDRIASAEAA ALKDVKDRAVQVAVAAAAEVLANQMSASDKSGMIDAAITEVETRLN
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, housing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits.

This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Protein Families
ATPase B chain family
Subcellular Location
Cellular chromatophore membrane; Single-pass membrane protein.

Q&A

What is the gene organization of ATP synthase in Rhodobacter capsulatus and where does atpF fit in this structure?

The ATP synthase genes in Rhodobacter capsulatus are organized into separate operons for the F₁ and F₀ sectors. The F₁ sector is encoded by the atpHAGDC operon, which has been fully cloned and sequenced . This organization resembles that found in related photosynthetic bacteria like Rhodospirillum rubrum and Rhodopseudomonas blastica, where F₁ and F₀ genes are located in different regions of the chromosome .

The atpF gene, which encodes subunit b, is part of the F₀ sector operon. While the search results indicate that cloning and sequencing of the F₀ operon was still in progress at the time of publication , it is known that subunit b serves as a critical stator component that connects the membrane-embedded F₀ portion to the catalytic F₁ portion of the ATP synthase complex.

The atpHAGDC operon contains a well-defined promoter region with elements resembling the -35 and -10 consensus sequences found in other operons of R. capsulatus, particularly those involved in bacteriochlorophyll and carotenoid biosynthesis . A rho-independent terminator sequence is present 23 bp downstream of the atpC stop codon, featuring a stem-loop structure, a GC-rich region, and a stretch of five T's .

How essential is ATP synthase for growth in R. capsulatus, and what implications does this have for recombinant studies?

ATP synthase is absolutely essential for the viability of R. capsulatus under all tested growth conditions, including aerobic, photosynthetic, and anaerobic growth with DMSO as the final electron acceptor . Researchers were unable to obtain viable cells with deletions in the atpHAGDC operon despite extensive efforts, indicating that functional ATP synthase is required for cell survival .

This essentiality creates significant challenges for researchers working with recombinant ATP synthase components, including subunit b (atpF). To overcome this limitation, researchers have developed a combined approach using gene transfer agent (GTA) transduction and conjugation to introduce mutations into essential genes . This method allowed for the construction of strains carrying a chromosomal deletion in the atpHAGDC operon while maintaining a functional copy on a complementing plasmid .

For studies involving recombinant atpF, this approach would be highly valuable, as it allows for the introduction of mutated versions while maintaining cell viability. The experimental protocol involves:

  • Construction of a plasmid carrying the wild-type gene or operon

  • Introduction of this plasmid by conjugation

  • Subsequent deletion of the chromosomal copy using GTA-mediated gene transfer

  • Replacement with mutated versions for functional studies

What methods are available for expressing and purifying recombinant R. capsulatus ATP synthase subunit b?

While the provided search results don't specifically address expression and purification of recombinant subunit b (atpF), several methodological approaches can be inferred from the work with other ATP synthase components.

For cloning and expression, researchers have successfully used PCR amplification with primers designed based on conserved regions identified from sequence alignments with close relatives like Rhodospirillum rubrum . For subunit b, primers would target conserved regions identified from multiple sequence alignments of related photosynthetic bacteria.

Expression systems would likely involve either:

  • Homologous expression in R. capsulatus using broad-host-range plasmids like pRK415, which was successfully used for complementation studies

  • Heterologous expression in E. coli, which is commonly used for bacterial membrane proteins

Purification of recombinant subunit b would present challenges due to its hydrophobic nature and membrane association. Researchers would typically employ:

  • Membrane solubilization using detergents like DDM, CHAPS, or Triton X-100

  • Affinity chromatography using engineered tags (His-tag, GST, etc.)

  • Additional purification steps such as ion exchange or size exclusion chromatography

What functional assays are used to characterize recombinant ATP synthase components from R. capsulatus?

Functional characterization of ATP synthase components, including subunit b, typically involves both in vivo and in vitro approaches:

In vivo assays include:

  • Complementation of deletion mutants to assess functionality of the recombinant protein

  • Growth rate measurements under different conditions (aerobic, photosynthetic, anaerobic)

  • Monitoring membrane potential using electrochromic carotenoid bandshifts

In vitro approaches include:

  • ATP synthesis assays using purified components or membrane vesicles (chromatophores)

  • Proton translocation measurements using pH indicators

  • ATP release quantification using luminescence of luciferin-luciferase

These methods have been successfully applied to study proton transfer through ATP synthase and ATP release in R. capsulatus chromatophores . The ratio between protons translocated and ATP yield can be measured, providing insights into the coupling efficiency of the enzyme . For subunit b specifically, its role in maintaining the proper connection between F₀ and F₁ sectors would be assessed through these functional assays.

What strategies can be employed to introduce site-directed mutations in the atpF gene given its essential nature?

Introducing site-directed mutations into essential genes like atpF requires sophisticated genetic approaches. Based on the research with the F₁ operon in R. capsulatus, the following strategy has proven effective and could be adapted for atpF studies:

This methodological framework allows researchers to introduce potentially deleterious mutations into essential genes like atpF while maintaining cell viability through complementation.

How does the coupling of proton flow through F₀ with ATP synthesis in F₁ work in R. capsulatus, and what role does subunit b play?

The coupling mechanism between proton flow and ATP synthesis in R. capsulatus ATP synthase involves intricate interactions between the F₀ and F₁ sectors, with subunit b serving as a critical stator component.

Research with R. capsulatus chromatophores has revealed important insights into this coupling mechanism:

  • Proton-to-ATP ratio: The ratio between protons translocated and ATP synthesized varies depending on experimental conditions. It decreases from an apparent value of 13 after the first light flash to about 5 when averaged over three flashes . This suggests dynamic coupling rather than a fixed stoichiometry.

  • Two-component proton transfer kinetics: Proton transfer through F₀F₁ exhibits two distinct kinetic components:

    • A fast component (~6 ms)

    • A slower component (~20 ms)
      Both components are present during ATP synthesis and during proton slip (in the absence of ADP) .

  • Energy storage mechanism: The transfer of initial protons in each tetrad appears to create strain in the enzyme that slows the translocation of subsequent protons . This energy storage mechanism is essential for coupling the transfer of four protons with the synthesis of one ATP molecule.

Subunit b likely plays several crucial roles in this coupling process:

  • Maintaining the structural integrity of the stator connection between F₀ and F₁

  • Transmitting conformational changes between the proton channel in F₀ and the catalytic sites in F₁

  • Preventing rotational slipping of the F₁ sector relative to the F₀ sector during catalysis

Mutations in subunit b would be expected to affect the efficiency of this coupling process, potentially altering the proton-to-ATP ratio or the kinetics of proton transfer.

What are the structural and functional differences between ATP synthase subunit b in R. capsulatus compared to other bacterial species?

While the search results don't provide specific information about subunit b (atpF) in R. capsulatus, comparative analysis can be inferred from what is known about other subunits and related species.

ATP synthase from R. capsulatus shows high sequence conservation with other photosynthetic bacteria and substantial homology with non-photosynthetic bacteria and eukaryotic organisms . For instance:

  • The α and β subunits show 74-86% identity with those from Rhodospirillum rubrum and Rhodopseudomonas blastica

  • Significant homology exists with E. coli (55-69% identity) and bovine mitochondria (68-78% identity)

For subunit b specifically, key differences might include:

  • Adaptations related to the photosynthetic lifestyle of R. capsulatus

  • Structural elements that interact with photosynthetic complexes

  • Modifications that function in the context of chromatophore membranes

The high conservation of catalytic sites observed in other subunits suggests that the functional domains of subunit b would likely be conserved, while membrane-interaction domains might show greater variability reflective of the different membrane environments.

Structural studies would be necessary to fully characterize these differences, potentially using approaches similar to those that yielded the atomic structure of F₁ from bovine heart mitochondria (2.8 Å resolution by X-ray crystallography) .

How can one distinguish between slip and coupled proton flow through ATP synthase in R. capsulatus?

Distinguishing between slip (uncoupled proton translocation) and coupled proton flow is crucial for understanding ATP synthase function. Research with R. capsulatus chromatophores has revealed several methodological approaches:

  • Comparative measurements in the presence and absence of ADP:

    • In the absence of ADP, protons "slip" through F₀F₁ without ATP synthesis

    • The slower component (~20 ms) of proton transfer is substantially suppressed during slip

    • This differential response provides a clear marker to distinguish coupled from uncoupled proton flow

  • Simultaneous monitoring of multiple parameters:

    • Membrane potential changes (using electrochromic carotenoid bandshift)

    • Proton translocation (using pH indicators)

    • ATP release (using luminescence of luciferin-luciferase)

    The correlation between these parameters reveals whether proton flow is productively coupled to ATP synthesis.

  • Proton-to-ATP ratio calculation:

    • A decreasing ratio with increasing flashes (from ~13 to ~5) indicates a complex coupling mechanism

    • Higher ratios suggest less efficient coupling or increased slip

These approaches can be applied to study the role of subunit b in maintaining coupling efficiency, as mutations in this subunit would be expected to potentially increase slip relative to coupled proton flow.

What genomic approaches can be used to study the regulation of ATP synthase expression in R. capsulatus, including the atpF gene?

Research on the CBB pathway genes in R. capsulatus provides insights into genomic approaches that could be applied to study ATP synthase regulation . These methods include:

  • Promoter fusion constructs:

    • Construction of reporter gene fusions (e.g., lacZ, gfp) to the promoter regions of ATP synthase operons

    • Measurement of expression levels under different physiological conditions

    • Analysis of regulatory elements through mutagenesis studies

  • Identification of transcriptional regulators:

    • Similar to the LysR-type transcriptional activators encoded by cbbR genes for the CBB pathway

    • Potential identification of regulators specific to energy metabolism genes

    • Characterization through DNA-binding assays and knockout studies

  • Operon structure and terminator analysis:

    • Detailed characterization of operon architecture, including potential internal promoters

    • Analysis of terminator sequences, such as the rho-independent terminator identified downstream of atpC

    • Investigation of potential post-transcriptional regulation mechanisms

  • Mutant strain characterization:

    • Creation of regulatory mutants and analysis of their effect on ATP synthase expression

    • Use of the GTA-conjugation approach to study essential regulatory elements

    • Complementation studies to confirm regulatory relationships

These genomic approaches would provide valuable insights into the regulation of ATP synthase genes, including atpF, under different physiological conditions relevant to the photosynthetic lifestyle of R. capsulatus.

What are the optimal growth and induction conditions for recombinant expression of R. capsulatus ATP synthase components?

While the search results don't specifically address optimal conditions for recombinant expression, several key considerations can be inferred from the research on R. capsulatus:

Growth media and conditions:

  • RCV standard minimal medium with malate as the carbon source supports aerobic growth

  • RFD2 minimal medium (RCV modified with fructose and DMSO as final electron acceptor) can be used for anaerobic growth

  • Addition of 0.05% yeast extract improves growth under various conditions

Growth modes for different expression objectives:

  • Aerobic growth: Standard approach for high cell density

  • Photosynthetic growth: May enhance expression of energy metabolism genes

  • Anaerobic growth with DMSO: Alternative when studying respiratory chain components

Induction strategies:

  • For native promoters: Modulation of oxygen tension, light intensity, or carbon source

  • For heterologous promoters: Standard inducers like IPTG (for lac-based systems) or tetracycline (for tet-based systems)

Expression verification approaches:

  • Western blotting with antibodies against the target protein

  • Activity assays to confirm functional expression

  • Analysis of amino-terminal sequences to confirm proper processing

These considerations would be relevant for the expression of recombinant subunit b (atpF) in either homologous or heterologous systems.

What are the challenges in establishing an in vitro ATP synthesis system using recombinant R. capsulatus ATP synthase components?

Establishing an in vitro ATP synthesis system using recombinant components presents several technical challenges:

  • Reconstitution of membrane proteins:

    • Subunit b and other F₀ components are hydrophobic membrane proteins

    • Selection of appropriate detergents for solubilization without functional impairment

    • Reconstitution into liposomes with the correct orientation

  • Assembly of the complete F₀F₁ complex:

    • Ensuring proper stoichiometry of all subunits

    • Facilitating correct assembly of the multiple components

    • Verifying structural integrity of the assembled complex

  • Generation of proton gradients:

    • Methods to establish and maintain proton gradients across membranes

    • Use of chromatophores as a natural system (as demonstrated in flash experiments)

    • Artificial gradient generation using pH jumps or co-reconstituted proton pumps

  • Measurement approaches:

    • Sensitive detection of ATP synthesis using luciferase assays

    • Monitoring proton flow using pH indicators or electrochromic shifts

    • Time-resolved measurements to capture transition states

  • Distinguishing enzyme populations:

    • Ensuring homogeneity of the reconstituted enzyme

    • Accounting for partial reactions or incomplete assembly

    • Controlling for uncoupled proton translocation (slip)

These methodological considerations are crucial for researchers aiming to study the function of recombinant ATP synthase components, including subunit b, in defined in vitro systems.

How can site-directed mutations in atpF be designed to probe specific aspects of ATP synthase function?

Rational design of mutations in subunit b (atpF) requires careful consideration of structural and functional aspects:

  • Structure-based mutation design:

    • Targeting conserved residues identified through multiple sequence alignments

    • Focus on the interface between subunit b and other stator components

    • Mutations affecting the membrane-spanning domain versus the peripheral stalk

  • Functional domain analysis:

    • Mutations affecting proton coupling efficiency

    • Alterations to the stator function to study rotational catalysis

    • Modifications to interfaces with both F₀ and F₁ sectors

  • Experimental validation approaches:

    • Implementation of the GTA-conjugation method for introducing mutations

    • Complementation testing to assess functionality in vivo

    • In vitro assays to measure specific functional parameters

  • Specific mutation categories:

    • Conservative substitutions to probe subtle structural requirements

    • Charge-altering mutations to investigate electrostatic interactions

    • Introduction of reporter groups (e.g., cysteine residues for labeling studies)

    • Truncations to define essential regions

These approaches would enable researchers to systematically probe the role of subunit b in maintaining the structural integrity of the ATP synthase complex and its function in coupling proton flow to ATP synthesis.

How should researchers interpret changes in proton-to-ATP ratios when studying mutant forms of ATP synthase?

The interpretation of altered proton-to-ATP ratios in mutant ATP synthase studies requires careful consideration of multiple factors:

  • Baseline ratio establishment:

    • Wild-type R. capsulatus ATP synthase shows a variable proton-to-ATP ratio (from ~13 after first flash to ~5 averaged over three flashes)

    • This variability reflects a complex coupling mechanism rather than a fixed stoichiometry

    • Baseline measurements should use identical experimental conditions as mutant studies

  • Increased ratios may indicate:

    • Reduced coupling efficiency (more protons per ATP)

    • Increased proton slip

    • Structural defects affecting the rotational mechanism

    • Changes in the energy storage capacity of the enzyme

  • Decreased ratios may suggest:

    • Altered energy threshold for catalysis

    • Modified conformational changes affecting catalytic site occupancy

    • Changes in the intrinsic catalytic rate

  • Kinetic component analysis:

    • Mutations affecting the fast (~6 ms) versus slow (~20 ms) components of proton transfer

    • Changes in the suppression of the slower component in the absence of ADP

    • Alterations to the strain creation mechanism proposed for energy storage

  • Experimental controls:

    • Measurements under both synthesis and slip conditions

    • Verification of enzyme structural integrity

    • Assessment of potential secondary effects on membrane properties

This analytical framework would be particularly valuable for interpreting the effects of mutations in subunit b, which could alter the structural coupling between proton translocation and catalytic site conformational changes.

What computational approaches can be used to model the structure and function of R. capsulatus ATP synthase subunit b?

Computational modeling provides valuable insights into structures that may be challenging to determine experimentally:

  • Homology modeling approaches:

    • Use of known structures from related organisms as templates

    • The high sequence identity between R. capsulatus ATP synthase and other bacterial/mitochondrial enzymes (55-86%) provides a strong foundation for accurate models

    • Refinement based on evolutionary conservation analysis

  • Molecular dynamics simulations:

    • Modeling of subunit b in membrane environments

    • Investigation of conformational changes during the catalytic cycle

    • Analysis of interactions with other subunits, particularly the α and β subunits of F₁

  • Quantum mechanical calculations:

    • For studying proton transfer events at the atomic level

    • Investigation of energy storage mechanisms within the protein structure

    • Modeling of the proposed strain creation during sequential proton translocation

  • Coevolutionary analysis:

    • Identification of co-evolving residue pairs to infer structural contacts

    • Prediction of interaction interfaces with other subunits

    • Evolutionary constraints analysis to identify functionally important regions

  • Integration with experimental data:

    • Refinement of models based on mutagenesis results

    • Incorporation of spectroscopic data on conformational states

    • Validation using functional measurements of proton translocation and ATP synthesis

These computational approaches would complement experimental studies on subunit b, providing insights into its structural role in maintaining the connection between F₀ and F₁ sectors and its contribution to the coupling mechanism.

What are common pitfalls in working with recombinant ATP synthase components from R. capsulatus and how can they be addressed?

Researchers working with recombinant ATP synthase components frequently encounter several challenges:

  • Expression and solubility issues:

    • Membrane proteins like subunit b often have low expression levels

    • Formation of inclusion bodies in heterologous systems

    • Solution: Optimization of growth temperature, induction conditions, and use of solubility tags

  • Complementation failures:

    • Inability to complement chromosomal deletions despite plasmid presence

    • Solution: Verify expression using Western blotting; ensure proper promoter function; check for deleterious mutations introduced during cloning

  • GTA-conjugation method difficulties:

    • Low efficiency of obtaining positive events (requires ~4 × 10⁹ cells)

    • Solution: Scale up culture volumes; optimize GTA particle production; improve selection strategies

  • Functional reconstitution challenges:

    • Improper assembly of the complex from individual components

    • Loss of activity during purification

    • Solution: Co-expression strategies; gentle purification conditions; reconstitution optimization

  • Proton leakage during functional assays:

    • Difficulty distinguishing between coupled proton flow and slip

    • Background proton movement through damaged membranes

    • Solution: Careful preparation of chromatophores or proteoliposomes; use multiple measurement techniques (carotenoid bandshift, pH indicators, ATP detection)

These troubleshooting approaches are essential for successful experimental work with recombinant ATP synthase components, including subunit b.

How can researchers verify the proper assembly and orientation of recombinant ATP synthase in membrane systems?

Verification of proper assembly and orientation is crucial for functional studies of recombinant ATP synthase:

  • Biochemical verification methods:

    • Subunit composition analysis using SDS-PAGE and Western blotting

    • Blue native PAGE to assess intact complex formation

    • Crosslinking studies to verify subunit proximity relationships

  • Orientation determination approaches:

    • Protease accessibility studies (asymmetric susceptibility to proteolysis)

    • Antibody binding to epitope tags placed at strategic positions

    • Chemical labeling of accessible cysteine residues

  • Functional verification strategies:

    • Direction-specific ATP synthesis versus hydrolysis assays

    • Proton pumping measurements using fluorescent probes

    • Analysis of kinetic components in proton transfer measurements

  • Structural verification techniques:

    • Electron microscopy of negatively stained samples

    • Atomic force microscopy of membrane-reconstituted complexes

    • Mass spectrometry-based approaches for subunit stoichiometry

  • Genetic complementation tests:

    • Ability to rescue chromosomal deletion mutants

    • Growth under conditions requiring functional ATP synthase

    • Phenotypic analysis under different energy metabolism conditions

These verification methods are essential for ensuring that experimental observations reflect the properties of properly assembled and oriented ATP synthase complexes, particularly when studying the role of subunit b in maintaining structural integrity.

What are promising approaches for studying the dynamic interactions between subunit b and other ATP synthase components during catalysis?

Future research on the dynamic interactions of subunit b could explore several innovative approaches:

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor distance changes

    • High-speed atomic force microscopy to visualize conformational dynamics

    • Optical or magnetic tweezers to study mechanical properties of the stator

  • Time-resolved structural methods:

    • Time-resolved cryo-electron microscopy to capture catalytic intermediates

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

    • Pulsed electron paramagnetic resonance to measure distance changes between labeled sites

  • Advanced kinetic approaches:

    • Further development of the flash photolysis system to study initiation events

    • Correlation of proton transfer components with specific conformational changes

    • Real-time monitoring of strain accumulation during sequential proton translocation

  • Genetic approaches:

    • Application of the GTA-conjugation method to introduce specific reporter groups

    • Development of suppressor mutation screens to identify interaction partners

    • Construction of chimeric proteins to define domain-specific functions

These approaches would provide unprecedented insights into how subunit b contributes to the coupling mechanism between proton flow and ATP synthesis in R. capsulatus ATP synthase.

How might the study of R. capsulatus ATP synthase contribute to our understanding of bioenergetic adaptation in photosynthetic bacteria?

The study of R. capsulatus ATP synthase offers unique insights into bioenergetic adaptation:

  • Comparative analysis opportunities:

    • Distinct organization of F₀ and F₁ operons compared to non-photosynthetic bacteria

    • Evolution of regulatory mechanisms specific to photosynthetic lifestyle

    • Adaptation of coupling mechanisms to variable energy input from photosynthesis

  • Integration with other bioenergetic systems:

    • Interaction between ATP synthase and photosynthetic apparatus

    • Coordination with electron transport chains under different growth conditions

    • Regulatory networks linking carbon fixation and energy conservation

  • Physiological adaptability:

    • Essential nature of ATP synthase under all growth conditions

    • Adaptation to fluctuating light conditions and variable proton gradients

    • Dynamic coupling mechanisms as revealed by variable proton-to-ATP ratios

  • Evolutionary perspectives:

    • Conservation patterns in photosynthetic versus non-photosynthetic organisms

    • Specialized adaptations in membrane composition and protein-lipid interactions

    • Convergent versus divergent evolutionary solutions to similar bioenergetic challenges

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.