Recombinant Rhodobacter capsulatus Biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rhodobacter capsulatus BioY

Recombinant Rhodobacter capsulatus BioY is a substrate-specific transmembrane protein (S unit) that functions as a biotin transporter in prokaryotic cells. BioY belongs to a larger family of Energy-Coupling Factor (ECF) transporters, which represent a significant group of importers for trace nutrients in prokaryotes . The BioMNY system of Rhodobacter capsulatus serves as the prototype of subclass I ECF transporters, importing biotin molecules with very high affinity . What makes BioY particularly interesting is its ability to function as a solitary unit, even when separated from its energy-coupling components (BioM and BioN). In its solitary state, BioY operates as a low-affinity biotin transporter, while in combination with BioM and BioN, it transforms into a high-affinity transport system .

When the bioY gene from R. capsulatus is expressed heterologously in recombinant Escherichia coli, it confers biotin transport activity on the host cells . This characteristic has made recombinant BioY an excellent model system for studying the structure-function relationships of substrate-specific components of ECF transporters. Beyond R. capsulatus, researchers have found that solitary BioY proteins from various other prokaryotic sources can also transport biotin into recombinant E. coli cells, highlighting the consistent functionality of this protein family across different species .

Genomic Context and Distribution of BioY

The bioY gene exists in various genomic contexts across prokaryotic species, which provides valuable insights into its evolutionary significance and functional versatility. Comparative genomic analyses have revealed that approximately one-third of bioY genes are linked to bioMN, forming complete bioMNY operons that encode subgroup I biotin transporters . These operons produce tripartite transport systems consisting of the substrate-specific BioY (S unit), the transmembrane BioN (T unit), and the ATP-binding BioM (A unit).

Genomic context studies have also found that many bioY genes are located at loci encoding biotin biosynthesis enzymes, while others remain unlinked to biotin metabolic or transport genes . This diverse genomic positioning further emphasizes the evolutionary versatility of bioY and suggests potential functional adaptations across different bacterial species.

Membrane Topology and Architecture

Recombinant R. capsulatus BioY exhibits a six-transmembrane-helix architecture, which has been determined through various structural prediction methods . This topology resembles that of other S units like RibU and ThiT, despite minimal amino acid sequence identity (<15%) between these proteins . The six-transmembrane-helix model is supported by hydropathy profile analysis and in silico predictions using the TOPCONS server .

A notable structural feature is the presence of a very short transmembrane helix II, which appears to be a common characteristic among S units of ECF transporters . The unique membrane topology of BioY likely plays a crucial role in its substrate recognition and transport mechanism. Secondary structure analysis using the SWISS-MODEL server has allowed researchers to construct a three-dimensional model of R. capsulatus BioY that closely resembles the crystal structures of related S units .

Conserved Amino Acid Residues

Among the approximately 200 BioY sequences cataloged in the SEED database, several highly conserved amino acid residues have been identified . Particularly notable is the F₁₆₀xxxD₁₆₄xxK₁₆₇ signature in transmembrane helix VI, where x represents any amino acid residue . The high degree of conservation of D₁₆₄ and K₁₆₇ across BioY proteins from diverse species suggests their critical importance in biotin recognition and transport .

Other conserved residues in BioY include various glycine and proline residues distributed throughout the protein sequence, which likely contribute to structural flexibility and proper folding of the transmembrane helices . The conservation pattern of these amino acids across the BioY family points to their functional or structural significance, making them valuable targets for site-directed mutagenesis studies.

Solitary Transport Activity

A distinctive feature of recombinant R. capsulatus BioY is its ability to function as a biotin transporter even in its solitary state, without the need for energy-coupling components . When expressed heterologously in E. coli cells deficient in biotin synthesis and lacking endogenous biotin transporters, solitary BioY confers biotin uptake activity on the recombinants . This activity is evident from both direct [³H]biotin uptake assays and from the growth of recombinant cells on media containing trace levels of biotin .

High-Affinity Transport in the BioMNY Complex

When BioY associates with BioM and BioN to form the complete BioMNY complex, it transforms into a high-affinity biotin transport system with a KT of approximately 5 nM for biotin . The BioMNY system imports biotin molecules slowly but with very high affinity, representing the prototype of subclass I ECF transporters .

The conversion of BioY from a low-affinity to a high-affinity transporter in the presence of BioM and BioN demonstrates the crucial role of these energy-coupling components in optimizing the transport function. BioMNY-mediated biotin uptake is severely impaired by replacement of the Walker A lysine residue in BioM, confirming the dependency of high-affinity transport on a functional ATPase . This finding establishes that ATP hydrolysis by BioM provides the energy required for efficient biotin uptake by the complete complex.

Evidence for BioY Dimerization

The oligomeric state of BioY has been a subject of extensive investigation, with multiple lines of evidence pointing to its dimerization as a critical aspect of its function. Fluorescence anisotropy analysis of fluorophore-tagged variants of BioY has demonstrated that the protein oligomerizes in vivo . Additionally, in vivo Förster resonance energy transfer (FRET) experiments have identified energy transfer between BioY copies tagged with fluorophores, further supporting a dimeric state of BioY in living cells .

To directly investigate the functional relevance of dimerization, researchers constructed a tail-to-head-linked BioY dimer . Both monomeric and artificially dimeric forms of BioY conferred comparable biotin uptake activities when expressed in recombinant E. coli, suggesting that the ability to dimerize is inherent to the protein and important for its function .

Biotin Binding Stoichiometry in Monomers and Dimers

Quantitative mass spectrometry has revealed fascinating insights into the biotin binding capabilities of BioY monomers and dimers. Purified BioY monomers have been found to contain biotin at a stoichiometry of approximately 1:2 (bound biotin per single BioY domain) . In contrast, the artificially constructed BioY dimers exhibited a stoichiometry of about 1:4 (referring to single BioY domains) . These findings suggest that not all potential binding sites in BioY oligomers are occupied simultaneously, which may have implications for the cooperative binding and transport mechanisms.

Gel filtration analysis of purified BioY consistently identifies at least two species in detergent solution: a slow-eluting (putative monomeric) form and a fast-eluting form likely representing the dimer . This pattern appears to be a general property of members of the BioY family rather than a specific feature of R. capsulatus BioY, as similar behavior has been observed with BioY proteins from other proteobacteria .

Critical Residues in Transmembrane Helix VI

Site-directed mutagenesis studies have identified specific amino acid residues crucial for the biotin transport function of BioY. In particular, the conserved Asp164 and Lys167 in transmembrane helix VI have been shown to be essential for activity . Replacement of Asp164 by Asn and Lys167 by Arg or Gln in the BioY monomer completely inactivated the protein, preventing biotin transport .

Implications for Transport Mechanism

The differential effects of mutations in the artificially constructed BioY dimer provide valuable insights into the transport mechanism. The observation that mutations in one half of the dimer only slightly affected biotin binding but significantly reduced transport activity suggests that intermolecular interactions between domains from different dimers are necessary for full functionality . This finding implies a cooperative mechanism where multiple BioY units work together to facilitate biotin transport across the membrane.

The essential role of the last transmembrane helix in biotin recognition further indicates that this region forms part of the substrate-binding pocket . The charged residues Asp164 and Lys167 likely interact directly with biotin or contribute to the proper conformation of the binding site, highlighting their crucial importance in the transport process.

Expression Systems and Functional Assays

Recombinant expression of R. capsulatus BioY in E. coli has been a powerful approach for studying its transport properties. Researchers have constructed specialized E. coli strains deficient in biotin synthesis (ΔbioH) and lacking the endogenous high-affinity biotin transporter (ΔyigM) to serve as reference systems for biotin transport studies . These strains are viable in media containing either high levels of biotin or a precursor of the downstream biosynthetic pathway but are non-viable on trace levels of biotin .

Expression of solitary bioY genes in these reference strains confers biotin uptake activity, which can be measured through direct [³H]biotin uptake assays . Additionally, the growth of the recombinants on media containing trace levels of biotin provides a functional readout of BioY activity . These complementation assays have been essential for evaluating the effects of mutations and studying the transport properties of BioY variants.

Complex Formation with Energy-Coupling Components

These findings suggest a hierarchical assembly process for the BioMNY complex, with BioM and BioN forming a stable subcomplex that subsequently associates with BioY. The complexity of these interactions underscores the sophisticated molecular architecture of ECF transporters and highlights the unique role of BioY as a substrate-specific component that can function both independently and as part of a larger complex.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
bioY; RCAP_rcc03249; Biotin transporter BioY; Biotin ECF transporter S component BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
bioY
Target Protein Sequence
MERNVTLIGLFAALIVALGFVPAIPLGFGVPITLQSLGVMLAGAVLGSWRGALAVLLVQA LVAIGLPVLAGGRGGLGIFVGPTAGFLIGWLPAAFVTGLIVERLRRVPVALAAGIGATLG GIIIMYALGILGFWLVKNAGLKPEDAPISLWAATAIMAPFIPGDLVKVVVTGLVARTIAQ YRPSALLARG
Uniprot No.

Target Background

Function
This central protein confers the ability to take up biotin in E. coli. While biotin transport requires BioM at very low (pM) concentrations, at higher (nM) concentrations, expression of BioY alone is sufficient for uptake.
Database Links
Protein Families
BioY family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the BioY protein from Rhodobacter capsulatus?

BioY is the substrate-specific transmembrane component (S unit) of the BioMNY energy-coupling factor (ECF) transporter system in Rhodobacter capsulatus. It functions as a biotin transporter and can operate both as part of the complete BioMNY complex and in its solitary state. The protein is approximately 20 kDa in size and contains six transmembrane helices. The BioMNY system from R. capsulatus is the prototype of subclass I ECF transporters and was the first system for which the tripartite composition of S, T, and A units was biochemically demonstrated .

How does solitary BioY function compared to the complete BioMNY complex?

The solitary BioY protein functions as a low-affinity biotin transporter, while the complete BioMNY holotransporter functions as a high-affinity system. Based on experimental data, the BioMNY holotransporter demonstrates a KT of approximately 5 nM for biotin, whereas solitary BioY has approximately 50-fold lower affinity (about 250 nM) . This difference highlights the critical role that the energy-coupling modules (BioM and BioN) play in enhancing substrate binding efficiency and transport capabilities of the S-unit.

Transporter FormBiotin Affinity (KT)Relative Efficiency
BioMNY complex~5 nMHigh
Solitary BioY~250 nMLow (50x lower)

What are the key considerations when designing experiments to study BioY oligomerization?

When designing experiments to study BioY oligomerization, researchers should implement several critical experimental design principles:

  • Control of variables: Maintain strict control over factors that might affect protein oligomerization, including membrane composition, expression levels, and cellular environment. This aligns with fundamental principles of experimental design in biological research .

  • Multiple complementary approaches: Employ at least three different techniques to cross-validate findings:

    • In vivo methods: Förster resonance energy transfer (FRET), fluorescence anisotropy

    • In vitro methods: Cross-linking studies with isolated membranes

    • Functional assays: Transport activity measurements with variants

  • Sample size and repetition: Collect data for a minimum of 5 repeats to enable calculation of standard deviation and perform proper statistical analysis. For correlation studies, more repeats may be necessary .

  • Data collection range: Include at least 5 levels of independent variables over a suitable range to establish reliable trends and relationships .

  • Quantitative analysis: Apply appropriate statistical tests with complete reporting of null/alternative hypotheses, degrees of freedom, critical values, and probability levels .

How should researchers approach the design of site-directed mutagenesis experiments for BioY?

When designing site-directed mutagenesis experiments for BioY, researchers should:

  • Target conserved residues: Focus on highly conserved amino acids across BioY homologs, such as Asp164 and Lys167, which have been demonstrated as critical for biotin transport function .

  • Apply strategic substitution principles:

    • Conservative substitutions (e.g., Asp to Asn, Lys to Arg) to maintain similar chemical properties while testing specific functional groups

    • Non-conservative substitutions (e.g., Lys to Gln) to more dramatically alter the local environment

  • Employ fusion protein strategies: Consider constructing tail-to-head-linked BioY dimers to analyze whether oligomerization is a requirement for function .

  • Implement systematic partial mutations: For dimeric structures, introduce mutations in only one half of the dimer while maintaining the other half as wild-type to assess domain-specific contributions to function .

  • Measure multiple functional parameters: Assess both transport activity and substrate binding to distinguish between effects on substrate recognition versus translocation mechanisms .

What evidence supports the dimeric state of BioY in vivo?

Multiple independent experimental approaches provide evidence for the dimeric state of BioY in vivo:

  • Fluorescence anisotropy analysis: Fluorophore-tagged variants of BioY dimers have been shown to oligomerize in vivo through fluorescence anisotropy measurements .

  • Functional studies with artificial dimers: Tail-to-head-linked BioY dimers demonstrate comparable biotin uptake activities to monomeric BioY when expressed in recombinant Escherichia coli, suggesting that the dimeric structure is functionally relevant .

  • Stoichiometric analysis: Quantitative mass spectrometry has identified biotin in purified BioY proteins at a stoichiometry of 1:2 for the BioY monomer and 1:4 (referring to single BioY domains) for the dimer .

  • Cross-linking experiments: In vitro cross-linking studies with isolated membranes have provided evidence for specific interactions between BioY subunits .

  • FRET experiments: In vivo Förster resonance energy transfer experiments have demonstrated proximity between BioY molecules, supporting oligomerization in the native membrane environment .

How do mutations in conserved amino acid residues affect BioY function?

Mutations in conserved amino acid residues produce differential effects on BioY function depending on context:

  • Complete inactivation in monomers: Replacement of the conserved Asp164 (by Asn) and Lys167 (by Arg or Gln) in the BioY monomer completely inactivates the proteins .

  • Partial effects in dimers: When these mutations are present in only one half of a BioY dimer:

    • Biotin binding is only slightly affected

    • Transport activity is reduced to varying degrees :

Mutation in Single Domain of DimerEffect on Transport ActivityEffect on Biotin Binding
Asp164AsnReduced to 25% of wild-typeSlightly affected
Lys167ArgReduced to 25% of wild-typeSlightly affected
Lys167GlnReduced to 75% of wild-typeSlightly affected
  • Transmembrane helix importance: The last transmembrane helix, which contains these conserved residues, plays an essential role in biotin recognition and transport .

  • Functional implications: These data suggest that intermolecular interactions between domains from different dimers contribute to functionality, further supporting an oligomeric architecture of BioY in living cells .

How should biotin binding stoichiometry data for BioY be analyzed?

Analysis of biotin binding stoichiometry data for BioY should follow these methodological approaches:

  • Quantitative mass spectrometry workflow:

    • Purify BioY protein variants under conditions that preserve native binding

    • Apply high-resolution mass spectrometry with appropriate calibration

    • Use internal standards for accurate quantification

    • Calculate molar ratios of biotin to protein

  • Statistical validation framework:

    • Collect data from at least 5 independent experiments

    • Calculate means and standard deviations

    • Apply appropriate statistical tests (t-test or ANOVA depending on comparisons)

    • Report all statistical parameters including degrees of freedom and p-values

  • Interpretation guidelines:

    • Compare observed stoichiometry with theoretical models (e.g., 1:1, 1:2, 2:2)

    • Correlate binding stoichiometry with transport activity measurements

    • Consider the relationship between oligomeric state and binding capacity

    • Evaluate alternative explanations for observed stoichiometry

  • Visualization standards:

    • Present raw data in clearly formatted tables

    • Include statistical analyses in figures with appropriate error representations

    • Use consistent formatting for presenting related data sets

What statistical approaches are appropriate for analyzing BioY transport activity?

For analyzing BioY transport activity data, appropriate statistical approaches include:

What techniques are most effective for studying BioY oligomerization in vivo?

Several complementary techniques provide powerful approaches for studying BioY oligomerization in vivo:

  • Förster Resonance Energy Transfer (FRET):

    • Tag different populations of BioY with appropriate donor and acceptor fluorophores

    • Measure energy transfer as evidence of close proximity (<10 nm)

    • Advantages: Non-invasive, real-time measurements in living cells

    • Limitations: Requires careful controls for fluorophore expression levels and orientation

  • Fluorescence Anisotropy:

    • Tag BioY with a fluorophore and measure changes in rotational diffusion

    • Oligomerization increases molecular size and reduces rotational freedom

    • Advantages: Sensitive to changes in molecular size; can be performed in living cells

    • Limitations: Indirect measure of oligomerization; affected by local environment

  • Genetic fusion approaches:

    • Create artificial dimers through tail-to-head linkage

    • Compare function with monomeric forms

    • Advantages: Tests functional relevance of oligomerization

    • Limitations: Artificial construct may not reflect natural arrangement

  • Site-directed mutagenesis with functional assays:

    • Introduce mutations at conserved residues (e.g., Asp164, Lys167)

    • Measure effects on transport activity and substrate binding

    • Create partially mutated dimers to assess inter-subunit interactions

    • Advantages: Directly tests functional importance of specific residues

    • Limitations: Mutations may have pleiotropic effects

How can mixed-methods approaches strengthen research on BioY function?

Mixed-methods approaches can significantly strengthen research on BioY function by:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.