Recombinant Rhodobacter capsulatus Cobalamin biosynthesis protein CobD (cobD)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

CobD is a partial or full-length protein (1–314 amino acids) encoded by the cobD gene in Rhodobacter capsulatus, a photosynthetic bacterium known for its versatile tetrapyrrole biosynthesis pathways . In cobalamin biosynthesis:

  • Function: CobD participates in the early stages of corrin ring assembly, converting uroporphyrinogen III into hydrogenobyrinic acid (HBA) .

  • Pathway Context: It operates alongside enzymes like CobG and CobZ in the aerobic pathway, which involves ring contraction and cofactor integration .

Recombinant Expression and Production

CobD is heterologously expressed in E. coli for functional studies and biotechnological applications:

ParameterDetailsSource
Expression SystemE. coli (plasmid-based)
TagN-terminal His-tag (full-length variants)
Purity>85% (SDS-PAGE validated)
StorageLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stability

Key Observations:

  • Partial vs. Full-Length: Early studies describe a partial recombinant CobD , while newer protocols yield full-length proteins .

  • Stability: Glycerol addition is critical to prevent degradation during long-term storage .

Role in Vitamin B₁₂ Production

CobD is integral to engineered pathways for cobalamin synthesis:

  • Artificial Operons: When cloned into E. coli alongside other cobalamin genes (e.g., cobZ), CobD enables HBA production, validating its essential role .

  • Comparative Studies: Deletion of cobD in recombinant systems abolishes HBA synthesis, underscoring its irreplaceable function .

Industrial Relevance

  • Bioproduction: Recombinant CobD supports scalable cobalamin production, addressing global demand for this vitamin in food and pharmaceutical industries .

  • Modular Engineering: In R. capsulatus, cobalamin pathways are often co-engineered with terpenoid biosynthesis (e.g., sesquiterpenes) under phototrophic conditions .

Research Gaps and Future Directions

  • Functional Elucidation: Detailed biochemical studies (e.g., substrate specificity, catalytic mechanism) remain sparse.

  • Structural Insights: Crystallographic data on CobD-intermediate complexes could clarify its role in corrinoid chemistry.

  • Biotechnological Optimization: Efforts to enhance E. coli expression yields or explore alternative hosts (e.g., R. capsulatus itself) are warranted .

Table 2: Comparative Expression Systems

HostAdvantagesLimitations
E. coliHigh yield, cost-effectiveLimited post-translational modification
R. capsulatusNative cofactor integrationLower expression efficiency

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
cobD; bluD; RCAP_rcc02054; Cobalamin biosynthesis protein CobD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
cobD
Target Protein Sequence
MNFAAMMVVAIGIDLALGWPDALYKRIGHPVTWIGALIARLEKGWNFKGRLRRLRGVLVA LAVIGTTVVIALAVQLWLPAGWPGVLIGGILAWPFVALRSMHDHVAAVAKPLIAGDLPGA RQAVSMIVGRDPSQLDQPGVARAALESLAENSSDGIVAPLFWGCVAGLPGIAGYKAINTL DSMIGHRTDRYEEFGWASARIDDLVNLIPARLTGLFFALASPCRARALAVMARDARSHRS PNAGWPEAAMAGALAVRLSGPRIYADRVANEPWLNGTAPDPRPADLARGLALYRRAMAGM TLVIGLVAVLWSVS
Uniprot No.

Target Background

Function
Catalyzes the addition of aminopropanol to the F carboxylic group of cobyric acid, converting it to cobinamide.
Database Links
Protein Families
CobD/CbiB family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rhodobacter capsulatus Cobalamin biosynthesis protein CobD?

Rhodobacter capsulatus Cobalamin biosynthesis protein CobD (UniProt ID: D5AV16) is a 314-amino acid protein involved in the vitamin B12 (cobalamin) biosynthetic pathway. The protein functions as an L-threonine-O-3-phosphate decarboxylase that generates (R)-1-amino-2-propanol-O-2-phosphate, a critical intermediate in cobalamin synthesis. CobD is also known by several synonyms, including bluD and RCAP_rcc02054 . The protein has been successfully expressed as a recombinant form with an N-terminal His-tag in E. coli expression systems, facilitating purification and functional studies .

What role does CobD play in the cobalamin biosynthesis pathway?

CobD catalyzes a critical step in the cobalamin biosynthetic pathway, specifically in the synthesis of aminopropanol phosphate and its attachment to the f side chain during the conversion of adenosylcobyric acid to adenosylcobinamide phosphate . The enzyme functions as an L-threonine-O-3-phosphate decarboxylase, generating (R)-1-amino-2-propanol-O-2-phosphate which serves as a building block for the nucleotide loop of cobalamin . This step occurs in both the aerobic and anaerobic pathways for cobalamin biosynthesis, as outlined in the pathway comparison table between P. denitrificans and S. Typhimurium . Interestingly, studies with S. Typhimurium cobD mutants have shown that cobalamin biosynthesis can be restored by adding exogenous (R)-aminopropanol, suggesting that a kinase phosphorylates this molecule before incorporation into cobyric acid .

What are the optimal conditions for recombinant CobD expression and purification?

Based on established protocols for Rhodobacter capsulatus CobD, the following methodology is recommended:

Expression System:

  • Host: E. coli (BL21 or similar expression strains)

  • Vector: pET or similar with N-terminal His-tag fusion

  • Induction: IPTG (0.5-1.0 mM) at OD600 of 0.6-0.8

  • Temperature: 16-25°C for 16-20 hours post-induction (to enhance solubility)

Purification Protocol:

  • Cell lysis in Tris/PBS-based buffer (pH 8.0)

  • Ni-NTA affinity chromatography (binding, washing, and elution with imidazole gradient)

  • Size exclusion chromatography if higher purity is required

  • Final buffer exchange to Tris/PBS with 6% trehalose at pH 8.0

The purified protein should be aliquoted with 5-50% glycerol (50% is recommended) and stored at -20°C/-80°C to avoid repeated freeze-thaw cycles, which may compromise activity .

How can I assess the enzymatic activity of recombinant CobD?

CobD enzymatic activity can be assessed through several complementary approaches:

Direct Activity Assay:

  • Monitor the decarboxylation of L-threonine-O-3-phosphate to generate (R)-1-amino-2-propanol-O-2-phosphate

  • Measure product formation using HPLC or mass spectrometry

  • Quantify CO2 release as a byproduct of decarboxylation

Complementation Assay:

  • Transform cobD-deficient bacterial strains (such as S. Typhimurium cobD mutants)

  • Supply the recombinant CobD protein or expression plasmid

  • Assess restoration of cobalamin biosynthesis through growth on minimal media or B12-dependent enzyme activity

Structure-Function Analysis:

  • Perform site-directed mutagenesis on conserved residues

  • Compare wild-type and mutant enzyme activities

  • Correlate activity changes with structural alterations at the active site

How does the structure of CobD relate to its enzymatic mechanism?

The structure of CobD (based on S. Typhimurium homolog data) reveals that it exists as a dimer in which each subunit consists of a large and a small domain . The enzyme belongs to the aspartate aminotransferase family, with its active site being most closely related to that observed in histidinol phosphate aminotransferase . This structural similarity suggests an evolutionary relationship between these enzymes.

Mechanistically, CobD catalyzes decarboxylation rather than amino transfer. Structural studies comparing the apo state, substrate-bound complex, and product-bound (external aldimine) complex have provided insights into how the enzyme directs the breakdown of the external aldimine toward decarboxylation instead of amino transfer . Key features include:

  • Positioning of the phosphate group of the substrate

  • Specific interactions with active site residues that stabilize reaction intermediates

  • Conformational changes upon substrate binding that promote decarboxylation

Researchers investigating CobD should consider these structural elements when designing experiments to probe catalytic mechanisms or engineer enzyme variants with altered properties.

What are the key differences between aerobic and anaerobic cobalamin biosynthesis pathways that affect CobD function?

The table below summarizes key differences between aerobic and anaerobic cobalamin biosynthesis pathways, with specific focus on the context in which CobD functions:

FeatureAerobic Pathway (P. denitrificans)Anaerobic Pathway (S. Typhimurium)
Cobalt insertionLate stageEarly stage
Ring contractionRequires molecular oxygenOxygen-independent
CobD roleSynthesis of aminopropanol phosphate and attachment to f side chainSame function but in different metabolic context
Pathway intermediatesWorks with non-cobalt containing intermediates until late stagesWorks with cobalt-containing intermediates throughout
Enzyme partnersInteracts with CobC and protein αInteracts with CbiP
Substrate availabilityMay be affected by oxygen-dependent upstream stepsLess affected by oxygen levels

Despite these differences, CobD performs essentially the same biochemical function in both pathways - synthesizing aminopropanol phosphate and facilitating its attachment to the f side chain during the conversion of adenosylcobyric acid to adenosylcobinamide phosphate . Understanding these pathway differences is critical when designing experiments to study CobD function in different bacterial systems.

How can structural information be used to engineer CobD variants with enhanced properties?

Structural information about CobD can guide protein engineering efforts to create variants with improved stability, activity, or substrate specificity. Based on the structural insights from the S. Typhimurium CobD homolog , several approaches can be considered:

Active Site Engineering:

  • Identify residues involved in substrate binding and catalysis through structural analysis

  • Introduce mutations that might enhance substrate binding affinity or catalytic efficiency

  • Modify the active site to accommodate alternative substrates

Stability Enhancement:

  • Analyze dimer interface residues and introduce mutations to strengthen subunit interactions

  • Identify regions susceptible to proteolysis or denaturation and engineer stabilizing modifications

  • Introduce disulfide bridges at strategic positions to enhance thermostability

Domain Engineering:

  • Create chimeric proteins by swapping domains between CobD homologs from different organisms

  • Engineer flexible linkers between large and small domains to optimize conformational dynamics

  • Fuse CobD with partner enzymes to create bifunctional catalysts for enhanced pathway efficiency

Experimental validation should follow each engineering approach, comparing wild-type and variant properties under standardized conditions.

Why might recombinant CobD show low or no enzymatic activity in vitro?

Several factors can contribute to poor enzymatic activity of recombinant CobD in vitro:

Protein Quality Issues:

  • Improper folding during expression (consider lower expression temperatures or chaperone co-expression)

  • Aggregation or precipitation (optimize buffer conditions with stabilizing agents like trehalose)

  • Loss of activity during freeze-thaw cycles (store in single-use aliquots with glycerol)

Assay Conditions:

  • Suboptimal pH or ionic strength (test range of conditions)

  • Missing cofactors or metal ions (investigate metal requirements)

  • Inhibitory compounds in the reaction mixture

Substrate Considerations:

  • L-threonine-O-3-phosphate quality or purity issues

  • Incorrect substrate concentration (perform enzyme kinetics to determine Km)

  • Alternative substrate requirements not identified in literature

To systematically troubleshoot, begin with protein quality assessment using techniques like size exclusion chromatography, dynamic light scattering, and circular dichroism before proceeding to optimize assay conditions.

How should experimental data from CobD studies be integrated with broader cobalamin biosynthesis research?

Researchers should consider these approaches for integrating CobD-specific findings with broader cobalamin biosynthesis research:

Pathway Context Analysis:

Comparative Studies:

  • Compare CobD from R. capsulatus with homologs from other organisms with known structures (e.g., S. Typhimurium)

  • Analyze conservation patterns across species to identify universally important residues

  • Correlate structural differences with functional variations

Systems Biology Approaches:

  • Incorporate CobD kinetic parameters into metabolic models of cobalamin biosynthesis

  • Predict pathway flux under different conditions or with engineered CobD variants

  • Design multi-enzyme experiments to evaluate pathway-level effects of CobD modifications

These integrative approaches will provide more meaningful insights than studying CobD in isolation.

What are promising research avenues for advancing understanding of CobD function and application?

Several promising research directions for CobD include:

Structural Biology:

  • Obtain high-resolution crystal structures of R. capsulatus CobD in different states (apo, substrate-bound, product-bound)

  • Employ cryo-EM to study CobD in complex with other pathway enzymes

  • Use NMR to investigate dynamic aspects of CobD function

Synthetic Biology Applications:

  • Engineer CobD for incorporation into synthetic cobalamin production pathways

  • Develop CobD variants with altered substrate specificity for novel product generation

  • Create fusion proteins that channel substrates between consecutive enzymatic steps

Comparative Biochemistry:

  • Characterize CobD homologs from diverse organisms to understand evolutionary adaptation

  • Investigate how CobD function varies between aerobic and anaerobic systems

  • Study how different organisms have evolved solutions to the same biosynthetic challenge

Computational Approaches:

  • Employ molecular dynamics simulations to understand conformational changes during catalysis

  • Use quantum mechanics/molecular mechanics (QM/MM) to elucidate detailed reaction mechanisms

  • Apply machine learning to predict beneficial mutations for enhanced enzyme performance

These research directions will contribute to both fundamental understanding of cobalamin biosynthesis and practical applications in biotechnology and synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.