Recombinant Rhodobacter capsulatus Cobalt transport protein CbiM (cbiM)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant CbiM is a 222-amino-acid membrane protein (UniProt ID: D5AUZ9) involved in cobalt transport. Produced in Escherichia coli with an N-terminal His-tag, it forms part of the CbiMNQO transporter complex essential for cobalt acquisition in Rhodobacter capsulatus .

PropertyDetails
Host OrganismRhodobacter capsulatus
Expression SystemEscherichia coli
Molecular Weight~25 kDa (calculated)
TagN-terminal His tag
Structural FeaturesSix transmembrane helices (SM1–SM6) with substrate-gating L1 loop

2.1. Role in Cobalt Transport

CbiM functions as the substrate-binding subunit of the group-I energy-coupling factor (ECF) transporter CbiMNQO. Key findings include:

  • ATPase Activation: CbiM stimulates ATP hydrolysis by the CbiQO module (ATP turnover rate: 2.4 μmol/min/mg) .

  • Substrate Gating: The L1 loop regulates cobalt entry, with mutations (e.g., Ala46/50→Trp) reducing transport efficiency by >60% .

  • Complex Stability: CbiM forms a stable subcomplex (1:1:2 molar ratio) with CbiQ and CbiO, while CbiN exhibits dynamic binding .

3.1. Vitamin B<sub>12</sub> Biosynthesis

Recombinant CbiM enables cobalt uptake in engineered E. coli strains for de novo vitamin B<sub>12</sub> production:

  • Co-expression with CbiN/Q/O increased cobalt uptake 12-fold, achieving 21.96 µg B<sub>12</sub>/g DCW .

  • Critical for aerobic B<sub>12</sub> pathways, as cobalt chelation requires intracellular cobalt supplied by CbiMNQO .

Genomic and Evolutionary Context

In Rhodobacter capsulatus SB1003:

  • The cbiM gene resides on the 3.7-Mb chromosome (66.6% GC content) .

  • CbiMNQO is evolutionarily distinct from ABC transporters, utilizing ECF modular architecture for micronutrient scavenging .

Research Challenges

  • CbiN Dynamics: Despite being nonessential for ATPase activity, CbiN’s role in coupling CbiM/Q conformational changes remains unresolved .

  • Expression Optimization: Low CbiN stability in recombinant complexes complicates mechanistic studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing it.
Synonyms
cbiM; RCAP_rcc02037; Cobalt transport protein CbiM; Energy-coupling factor transporter probable substrate-capture protein CbiM
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-222
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
cbiM
Target Protein Sequence
MHIMEGYLPVTHAIGWSLAAGPFVVAGAVKIRKIVAERPEARMTLAASGAFAFVLSALKI PSVTGSCSHPTGTGLGAVVFGPSVMAVLGVIVLLFQALLLAHGGLTTLGANAFSMAIVGP WVAWGVYKLAGKAGASMAVAVFLAAFLGDLATYVTTSLQLALAYPDPVSGFLGAALKFGS VFALTQIPLAIAEGFLTVIVVDALAGKVDDKDKLRILAGEAR
Uniprot No.

Target Background

Function
This protein is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, responsible for cobalt import. Expression in E. coli enables cobalt uptake. While it can transport nickel with very low affinity, a Cbi(MN) fusion protein exhibits approximately 70% import capacity. However, the holo-Cbi(MN)QO complex cannot be isolated, indicating that CbiN might destabilize it.
Database Links
Protein Families
CbiM family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of CbiM within the cobalt ECF transporter complex?

CbiM functions as the substrate-binding component (corresponding to EcfS) within the group-I cobalt ECF transporter CbiMNQO. The complete transporter consists of CbiM/CbiN (substrate-binding components), CbiQ (integral membrane scaffold component corresponding to EcfT), and CbiO (cytoplasmic ATP binding/hydrolysis component corresponding to EcfA). The structure of the CbiMQO complex has been determined in its inward-open conformation, while CbiO has been characterized in its β, γ-methyleneadenosine 5'-triphosphate-bound closed conformation .

How does CbiM contribute to cobalt transport mechanism?

CbiM serves as the primary substrate-binding subunit that directly interacts with cobalt ions. Research has demonstrated that CbiM stimulates CbiQO's basal ATPase activity, indicating its role in coupling substrate binding to ATP hydrolysis . The L1 loop of CbiM functions in substrate gating, controlling access to the binding site. The transport process appears to require rotation or toppling of both CbiQ and CbiM components, with CbiN possibly functioning as a coupler for conformational changes between these two proteins .

What expression systems have proven effective for recombinant production of R. capsulatus CbiM?

While specific expression systems for R. capsulatus CbiM are not explicitly detailed in the available literature, evidence from research with other R. capsulatus proteins suggests potential approaches. For instance, heterologous expression in Escherichia coli has been successfully employed for other R. capsulatus membrane proteins, as demonstrated with the RcNtrB protein that was overexpressed and purified as a maltose-binding protein fusion (MBP-RcNtrB) . This suggests that E. coli expression systems with appropriate fusion tags may be viable for CbiM expression.

What are the critical considerations for maintaining CbiM functionality during purification?

Membrane proteins like CbiM present significant purification challenges due to their hydrophobic nature. Based on successful approaches with other bacterial membrane transporters, researchers should consider:

  • Optimal detergent selection for membrane solubilization

  • Stabilization strategies during purification

  • Assessment of protein activity during each purification step

For R. capsulatus proteins specifically, the successful purification of MBP-RcNtrB maintained its autophosphorylation activity, reaching the same steady-state level as comparable proteins though at a lower initial rate . This suggests fusion protein approaches may help preserve protein function during purification.

How can researchers effectively reconstitute the CbiMNQO complex for functional studies?

Reconstitution of multi-component membrane protein complexes represents one of the most challenging aspects of studying transporters like CbiMNQO. Based on the structural studies of the complex, researchers have successfully employed reconstitution approaches that retained functional interactions between components . The key methodological considerations include:

  • Sequential addition of purified components

  • Verification of complex assembly through size-exclusion chromatography

  • Assessment of ATPase activity as a functional readout

  • Measurement of cobalt transport in reconstituted proteoliposomes

The relative stimulation of ATPase activity when CbiM interacts with CbiQO provides a useful functional assay to verify successful reconstitution .

What crystallization approaches have successfully yielded high-resolution structures of CbiM?

The CbiMQO complex structure has been determined at 3.5Å resolution , suggesting successful crystallization strategies have been developed. While specific crystallization conditions are not detailed in the available resources, researchers working with membrane proteins typically employ techniques such as:

  • Detergent screening to identify optimal micelle properties

  • Lipidic cubic phase crystallization for membrane proteins

  • Antibody-mediated crystallization to provide additional crystal contacts

  • Fusion protein approaches to enhance solubility and crystallization propensity

The availability of the 3.5Å structure (PDB: 5X41) provides a valuable template for molecular replacement in future crystallographic studies of CbiM variants .

What spectroscopic methods are appropriate for studying CbiM-cobalt interactions?

Based on general approaches for studying metal-binding proteins, researchers investigating CbiM-cobalt interactions might consider:

  • UV-visible spectroscopy to detect characteristic cobalt-coordination spectra

  • Electron paramagnetic resonance (EPR) to characterize the electronic state of bound cobalt

  • Isothermal titration calorimetry (ITC) to determine binding thermodynamics

  • X-ray absorption spectroscopy (XAS) to determine coordination environment

These techniques can provide complementary information about the nature of metal coordination by CbiM, though specific examples with R. capsulatus CbiM are not detailed in the available literature.

How can cobalt transport activity be quantitatively assessed in reconstituted systems?

Functional characterization of cobalt transport requires carefully designed assay systems. Based on approaches used with similar transporters, researchers might consider:

  • Radioisotope (57Co or 60Co) uptake assays with reconstituted proteoliposomes

  • Fluorescent cobalt analogs with real-time transport monitoring

  • Indirect assays coupling cobalt uptake to colorimetric reporter systems

  • Cobalt-dependent enzyme activity assays as functional readouts

The specific transport mechanism, involving ATP hydrolysis and conformational changes in the CbiMNQO complex , should inform assay design.

What methods can distinguish between binding and transport functions of CbiM?

Differentiating between substrate binding and complete transport is crucial for mechanistic studies. Researchers should consider:

  • Equilibrium binding assays using filtration or spectroscopic methods

  • Transport assays with sealed vesicles containing detection systems

  • Mutational analysis targeting the L1 loop of CbiM that functions in substrate gating

  • Coupling ATPase activity measurements with transport assays

The relationship between CbiM's stimulation of CbiQO's ATPase activity and actual cobalt translocation provides an important mechanistic window into transporter function .

How does group-I CbiM differ functionally from the equivalent components in group-II ECF transporters?

ECF transporters are classified into groups I and II, with CbiMNQO representing a group-I transporter. Understanding these differences has important implications:

  • Group-I transporters like CbiMNQO have dedicated components for specific substrates

  • The CbiM/CbiN combination in group I corresponds to the EcfS component in group II

  • Molecular understanding of group-I ECF transporters has been limited compared to group II

  • The working model for CbiMNQO suggests distinct conformational changes during transport

These differences highlight the specialized nature of cobalt transport mediated by CbiM compared to more general substrate transport in group-II systems .

What methodological approaches can assess the impact of anaerobic vs. aerobic growth conditions on CbiM expression and function?

R. capsulatus can be cultured under different growth conditions including photosynthetic (anaerobic) growth with illumination . Methodological approaches to study condition-dependent effects might include:

  • Controlled growth conditions with varying oxygen levels

  • Quantitative proteomics to measure CbiM expression levels

  • Transcript analysis using RT-qPCR for cbiM expression

  • Functional assays comparing transport activity from cells grown under different conditions

R. capsulatus cultures can be maintained under specific conditions, such as 80% full flasks agitated at 150 rpm for low aeration or completely filled, sealed vessels with illumination (~100 μM.m-2.s-1) for anaerobic photosynthetic growth .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.