Recombinant Rhodobacter capsulatus Cobalt transport protein CbiN (cbiN)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalt Transport

CbiN operates as part of the CbiMNQO ECF transporter, a modular system comprising:

  • CbiM: Substrate-binding component (extracytoplasmic) .

  • CbiN: Membrane-embedded scaffold .

  • CbiQO: Cytoplasmic ATP-binding cassette (ABC) subunits .

Mechanism of Action

  1. Substrate Binding: CbiM binds cobalt ions in the extracellular environment.

  2. Conformational Coupling: CbiN mediates interactions between CbiM and CbiQO, enabling ATP-dependent transport .

  3. ATP Hydrolysis: CbiQO catalyzes ATP hydrolysis, driving conformational changes for cobalt translocation .

Studies confirm CbiMNQO’s specificity for cobalt over nickel, distinguishing it from the NikMNQO nickel transporter .

Functional Validation

  • Heterologous Expression: CbiMNQO reconstituted in E. coli confirmed cobalt uptake activity .

  • Mutagenesis Studies: Disruption of cbiN in R. capsulatus impaired cobalt-dependent processes (e.g., urease activity) .

Comparative Genomics

CbiMNQO homologs are widespread in prokaryotes, often linked to cobalamin (B₁₂) biosynthesis genes . In R. capsulatus, the system is regulated by B₁₂ riboswitches .

Expression and Purification Protocols

StepDetails
Host StrainE. coli (for full-length, His-tagged CbiN) ; yeast (partial)
InductionIPTG or native promoters (e.g., P nif in R. capsulatus)
PurificationNi-NTA affinity chromatography (His-tag)
Purity CheckSDS-PAGE, Western blot

Applications in Biotechnology

CbiN serves as a tool for:

  1. Metal Resistance Studies: Investigating cobalt detoxification in engineered strains .

  2. Sustainable Bioengineering: Optimizing terpenoid biosynthesis in R. capsulatus via modular gene expression .

  3. Structural Biology: Elucidating ECF transporter mechanisms in pathogenic bacteria .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade activity; aliquoting is essential .

  • Functional Redundancy: Overlapping roles with other metal transporters (e.g., TRAP systems) complicate mechanistic studies .

  • Therapeutic Potential: Exploring CbiN as a target for disrupting cobalt-dependent pathogens .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize the development of the specified tag.
Synonyms
cbiN; RCAP_rcc02036; Cobalt transport protein CbiN; Energy-coupling factor transporter probable substrate-capture protein CbiN
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
cbiN
Target Protein Sequence
MSSKRTLWLLAGTVALVVVPLLMGGEFGGADGQAAELIEATVPGFAPWADPLWEPPSGEV ESLFFALQAALGAFVVGLVIGRRQGAAKTREQNAPAPRSFPAE
Uniprot No.

Target Background

Function
CbiN is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, involved in cobalt import. Expression of this complex in E. coli confers cobalt uptake capability. While it can also transport nickel, its affinity for nickel is very low. A Cbi(MN) fusion protein exhibits approximately 70% import capacity. However, the holo-Cbi(MN)QO complex cannot be isolated, suggesting that CbiN may destabilize it.
Database Links
Protein Families
CbiN family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rhodobacter capsulatus Cobalt transport protein CbiN and what is its functional significance?

Cobalt transport protein CbiN is a membrane protein component of the CbiMNQO transporter system in Rhodobacter capsulatus. CbiN is composed of two transmembrane helices tethered by an extracytoplasmic loop of 37 amino acid residues . The protein serves as an auxiliary component that temporarily interacts with the CbiMQO Co²⁺ transporter, facilitating metal insertion into the binding pocket .

CbiN plays a critical role in the uptake of cobalt ions, which are essential for the biosynthesis of coenzyme B₁₂ (vitamin B₁₂) . The CbiMNQO systems represent one of the most widespread groups of microbial transporters for cobalt ions . Functionally, CbiN has been shown to induce significant Co²⁺ transport activity even in the absence of CbiQO₂ in cells producing the S component CbiM plus CbiN or a Cbi(MN) fusion .

How is CbiN related to the broader family of bacterial transport systems?

CbiN belongs to the energy-coupling factor (ECF) transporter family, which is part of the ATP-binding cassette (ABC) transporter superfamily found in prokaryotes . Unlike typical ABC transporters, the metal-specific ECF systems like CbiMNQO rely on additional proteins with essential functions .

The standard architecture of ECF transporters includes:

  • A substrate-specific integral membrane protein (S) - CbiM in this case

  • A transmembrane coupling protein (T) - CbiQ

  • Cytoplasmic ATP-binding cassette family ATPases - CbiO

  • An auxiliary component (CbiN in cobalt transport systems)

While vitamin-specific ECF transporters typically function without auxiliary components, metal-specific systems like CbiMNQO require the additional CbiN component . This architectural distinction highlights the specialized nature of metal ion transport systems in prokaryotes.

What are the optimal methods for expressing recombinant CbiN in laboratory settings?

Successful expression of recombinant CbiN requires careful consideration of expression systems and conditions. Based on experimental evidence, the following methodological approach is recommended:

Expression Vector Selection:
The pRhon5Hi-2 expression vector has demonstrated efficacy for heterologous gene expression in R. capsulatus . This vector is derived from pRhotHi-2 and contains the nif promoter, which allows for controlled induction under specific conditions .

Transformation Protocol:

  • Transfer the expression plasmid to R. capsulatus via conjugational transfer using E. coli S17-1 as a donor

  • Select exconjugants on PY agar containing appropriate antibiotics (25 μg/mL kanamycin and 25 μg/mL rifampicin are commonly used)

  • Conduct photoheterotrophic cultivation in liquid RCV medium with antibiotics in airtight Hungate tubes

Induction Conditions:
For optimal expression, use a two-step cultivation process:

  • Pre-culture: 15 mL RCV medium containing 0.1% (NH₄)₂SO₄, incubated for 48 hours

  • Expression culture: Initial OD₆₆₀ₙₘ of 0.05 in 14 mL RCV medium containing 0.1% serine as the exclusive nitrogen source

The absence of ammonium combined with photoheterotrophic conditions (absence of oxygen) induces the nif promoter-dependent target gene expression .

What purification strategies yield the highest purity and activity of recombinant CbiN?

Purification of recombinant CbiN requires specialized techniques due to its membrane-associated nature. The following strategy has been demonstrated to yield highly pure and active protein:

Affinity Chromatography Approach:

  • Include a tag (His-tag is commonly used) at either the N or C-terminus of CbiN to facilitate purification

  • Solubilize membrane fractions with appropriate detergents (mild non-ionic detergents like DDM at 1% concentration)

  • Purify using nickel affinity chromatography with a step gradient of imidazole

  • Further purify using size exclusion chromatography to achieve homogeneity

Buffer Optimization:
The choice of buffer significantly affects CbiN stability and activity. The recommended buffer composition is:

  • Tris-based buffer (50 mM, pH 7.5)

  • 50% glycerol for storage

  • Detergent concentration just above the critical micelle concentration (CMC)

For extended storage, store working aliquots at 4°C for up to one week, or at -20°C for longer periods. Repeated freezing and thawing should be avoided .

How should experiments be designed to study CbiN-CbiM interactions?

The interaction between CbiN and CbiM is critical for cobalt transport activity. Studies have shown that CbiN-CbiM loop-loop interactions facilitate metal insertion into the binding pocket . To investigate these interactions, consider the following experimental design approach:

Cysteine-Scanning Mutagenesis and Crosslinking:

  • Generate a series of single-cysteine mutants in predicted interaction regions of both CbiN and CbiM

  • Test crosslinking between cysteine pairs to identify interaction sites

  • Validate interactions through functional assays measuring cobalt transport activity

This approach has successfully demonstrated that segments of the CbiN loop interact with loops in CbiM .

Electron Paramagnetic Resonance (EPR) Analysis:
Site-directed spin labeling followed by EPR analysis can reveal the dynamics of CbiN-CbiM interactions. This technique has shown that the CbiN loop adopts an ordered structure when interacting with CbiM .

Experimental Design Table for CbiN-CbiM Interaction Studies:

Experimental ApproachReadout MethodKey ControlsExpected Outcome
Cysteine-scanning mutagenesisCrosslinking efficiencyNon-interacting cysteine pairsIdentification of interacting regions
EPR with site-directed spin labelingMobility parametersSpin-labeled non-interacting proteinChanges in mobility indicating interaction
Solid-state NMRChemical shift changesIsotope-labeled individual proteinsDirect evidence of interaction interfaces
Functional transport assayMetal uptake measurementsCbiN loop deletion mutantsCorrelation between interaction and function

What experimental controls are essential when studying CbiN function?

When designing experiments to study CbiN function, the inclusion of appropriate controls is critical for valid interpretation of results. Based on the literature, the following controls should be considered:

For Genetic Studies:

  • Wild-type strain (e.g., R. capsulatus SB1003) as a positive control

  • Strains with disruptions in cbiM, cbiN, cbiQ, and cbiO individually to assess the contribution of each component

  • A strain with disruptions in both cbbL and cbbM as a reference for metabolic impact

For Transport Activity Assays:

  • CbiN loop deletion variants to demonstrate the essential nature of the extracytoplasmic loop

  • CbiM alone (without CbiN) to demonstrate the enhancement effect of CbiN

  • Non-functional CbiN mutants with specific substitutions in conserved residues

For Protein-Protein Interaction Studies:

  • Non-interacting protein pairs as negative controls

  • Known interacting proteins as positive controls

  • Competition with unlabeled proteins to confirm specificity

How can comparative genomics approaches be applied to study CbiN evolution and diversity?

Comparative genomics provides powerful tools for understanding the evolution and diversity of CbiN across bacterial species. The following methodological framework is recommended:

1. Identification of CbiN Homologs:

  • Use sequence-based searches (BLAST, HMM profiles) to identify CbiN homologs across diverse bacterial genomes

  • Examine genomic context to identify co-occurring genes, particularly those encoding other components of the CbiMNQO system

2. Genomic Context Analysis:

  • Analyze the organization of cbi genes in different organisms

  • Compare the presence of regulatory elements such as B₁₂ riboswitches, which have been found to regulate most of the candidate cobalt transporters in bacteria

3. Phylogenetic Analysis:

  • Construct phylogenetic trees of CbiN sequences to identify evolutionary relationships

  • Compare with species phylogeny to identify potential horizontal gene transfer events

4. Structural Prediction and Comparison:

  • Generate structural models of CbiN proteins from diverse species

  • Identify conserved features that may be essential for function

This approach has revealed that CbiMNQO and NikMNQO represent the most widespread groups of microbial transporters for cobalt and nickel ions , and that variants of the CbiMNQO-type transporters are the most common uptake systems for these metals .

What are the methodological considerations for designing mutant studies of CbiN?

Mutagenesis studies are essential for understanding structure-function relationships in CbiN. The following methodological framework should be considered:

Site-Directed Mutagenesis Strategy:

  • Target conserved residues identified through sequence alignment

  • Pay particular attention to the 37-amino acid extracytoplasmic loop, as any deletion in this region abolishes transport activity

  • Use alanine-scanning mutagenesis to identify functionally important residues

  • Consider charge-reversal mutations for residues predicted to be involved in electrostatic interactions

Construction of Mutant Strains:
For in vivo studies in R. capsulatus, mutant strains can be constructed using the following approach:

  • Create a plasmid with the disrupted gene using appropriate vector (e.g., pJP5603)

  • Mobilize the plasmid into R. capsulatus from E. coli S17-1 λpir

  • Force homologous recombination of the plasmid-borne disrupted gene into the wild-type copy

  • Select recombinant strains using appropriate antibiotics

  • Confirm disruption by Southern blotting and hybridization analysis

Functional Evaluation of Mutants:

Mutation TypeExpected ImpactFunctional AssayControl Comparison
Conserved loop residuesDisruption of CbiM interactionCobalt transport activityWild-type CbiN
Transmembrane helix residuesAltered membrane topologyMembrane insertion efficiencyWild-type CbiN
CbiM binding interfaceReduced interaction with CbiMCrosslinking efficiencyWild-type CbiN-CbiM pair
His2Asp substitutionAltered metal specificityMetal selectivity assayWild-type specificity profile

What are the common challenges in experimental studies of CbiN and how can they be addressed?

Research on CbiN presents several technical challenges that require specific solutions:

Challenge 1: Low Expression Levels

  • Solution: Optimize codon usage for the expression host

  • Employ fusion tags that enhance solubility (MBP, SUMO)

  • Consider alternative promoter systems, such as the nif promoter for expression in R. capsulatus

Challenge 2: Protein Instability

  • Solution: Include stabilizing agents in buffers (glycerol at 50%)

  • Optimize purification conditions to minimize protein denaturation

  • Consider expression as a fusion with CbiM (CbiMN fusion), which has shown enhanced stability

Challenge 3: Functional Assay Limitations

  • Solution: Develop sensitive metal uptake assays using isotope-labeled cobalt

  • Implement indirect functional assays, such as measuring ATPase activity of the associated CbiO component

  • Use complementation assays in knockout strains to validate function in vivo

Challenge 4: Membrane Protein Crystallization Difficulties

  • Solution: Consider alternative structural approaches like cryo-EM

  • Use detergent screening to identify optimal solubilization conditions

  • Employ lipid cubic phase crystallization techniques specifically designed for membrane proteins

How can contradictory findings in CbiN research be reconciled through experimental design?

When faced with contradictory findings in CbiN research, a systematic approach to experimental design can help reconcile discrepancies:

1. Standardize Experimental Conditions:

  • Use consistent expression systems and conditions across studies

  • Standardize buffer compositions and assay conditions

  • Employ the same functional readouts to ensure comparability

2. Apply Multiple Complementary Techniques:

  • Validate findings using orthogonal methods

  • Combine in vitro and in vivo approaches

  • Use both structural and functional assays to correlate structure-function relationships

3. Consider Strain-Specific Variations:

  • Different bacterial strains may show variations in CbiN function

  • Compare results across multiple strains of R. capsulatus

  • Consider using standardized reference strains (e.g., R. capsulatus SB1003)

  • Select appropriate sample sizes based on power calculations

  • Use randomization and blinding where applicable

  • Apply suitable statistical tests for the experimental design used

5. Employ Single-Case Design When Appropriate:
For detailed mechanistic studies, single-case designs may provide valuable insights:

  • Implement repeated measures to establish baseline behavior

  • Manipulate independent variables systematically

  • Consider randomization of phase lengths to enhance internal validity

What are the emerging research questions regarding CbiN function and regulation?

Several critical research questions remain to be addressed regarding CbiN:

  • Regulatory Mechanisms: How is CbiN expression regulated in response to changing cobalt availability? Studies have identified B₁₂ riboswitches regulating cobalt transporters , but the specific mechanisms controlling CbiN expression require further investigation.

  • Protein Dynamics: What conformational changes does CbiN undergo during the transport cycle? Current structural data suggest that the CbiN loop adopts an ordered structure during interaction with CbiM , but the dynamic nature of these changes during transport remains unclear.

  • Substrate Specificity: What determines the metal specificity of CbiN-containing transporters? Research has shown that a His2Asp substitution in CbiM can alter metal preference , but the role of CbiN in this specificity is not fully understood.

  • Integration with Cellular Metabolism: How is CbiN function integrated with cobalamin biosynthesis pathways? The co-localization of nickel/cobalt transporter genes with genes for coenzyme B₁₂ biosynthesis enzymes suggests coordinated regulation that warrants further study.

What novel experimental approaches could advance our understanding of CbiN structure and function?

Emerging technologies and approaches offer new opportunities to address longstanding questions about CbiN:

1. Cryo-Electron Microscopy:

  • Application: Determine high-resolution structures of the complete CbiMNQO complex in different conformational states

  • Advantage: Enables visualization of membrane proteins without crystallization

  • Expected outcome: Insight into the structural dynamics of the transport cycle

2. Single-Molecule FRET:

  • Application: Monitor real-time conformational changes in CbiN during interaction with CbiM and metal binding

  • Advantage: Provides dynamic information not accessible through static structural methods

  • Methodological considerations: Requires strategic placement of fluorophores at non-disruptive positions

3. Integrative Structural Biology Approach:
Combining multiple structural techniques can provide a more complete picture:

4. CRISPR-Based Approaches:

  • Application: Create precise genomic modifications to study CbiN function in native contexts

  • Advantage: Allows manipulation of endogenous genes without plasmid-based expression

  • Methodological consideration: Design guide RNAs with high specificity for targeted modifications

5. Multivariate Experimental Design:
Applying statistical experimental design methodology allows evaluation of multiple variables simultaneously:

  • Identify significant factors affecting CbiN expression and function

  • Optimize conditions using factorial designs

  • Reduce experiment numbers while maintaining statistical power

This systematic approach permits thorough analysis compared to univariate methods and enables characterization of experimental error while gathering high-quality information with fewer experiments .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.