Recombinant Rhodobacter capsulatus Cobalt transport protein CbiQ (cbiQ)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cobalt Transport

CbiQ is essential for high-affinity cobalt uptake, as demonstrated in Salmonella enterica and Rhodobacter capsulatus . Key mechanisms include:

  • ATP-Dependent Transport: CbiO hydrolyzes ATP to drive cobalt translocation across the membrane .

  • Regulation: Operons containing cbiQ are often regulated by B<sub>12</sub> riboswitches or LysR-type transcriptional activators (e.g., cbbRI) .

  • Physiological Relevance: Enables cobalt acquisition for metalloenzymes like coenzyme B<sub>12</sub> .

Production and Purification

Recombinant CbiQ is produced under optimized conditions:

ParameterSpecification
Expression VectorpET-based plasmid in E. coli
Purification MethodImmobilized metal affinity chromatography (IMAC) via His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer (6% trehalose, pH 8.0); stable at -80°C
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 50% glycerol for long-term storage

Research Applications

  • Mechanistic Studies: Used to elucidate conformational dynamics of ECF transporters .

  • Metal Homeostasis: Functional assays demonstrate cobalt specificity over nickel .

  • Biotechnological Engineering: Template for designing synthetic transporters for biofortification or bioremediation .

Evolutionary and Genomic Context

Phylogenetic analysis suggests cbiQ in R. capsulatus shares ancestry with "green-like" RubisCO-containing bacteria, likely acquired via horizontal gene transfer . The cbiMNQO operon is conserved in prokaryotes, underscoring its role in micronutrient uptake .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cbiQ; cbiQ2; RCAP_rcc02035; Cobalt transport protein CbiQ; Energy-coupling factor transporter transmembrane protein CbiQ
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-244
Protein Length
full length protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
cbiQ
Target Protein Sequence
MSIASIDRVAAQGRWRNRPLAEKCLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARV PLRFWAAVAVLPLGFLTTGAAVLLIQIGPDGIGLAPQGPAKAAALVMRASAATCCLLFLA TTTPAADLLSGLRRWRVPAELIEIALLTYRFVFILAEEAAAMTTAQRARLGHATRRRWLR STAQVIAALLPRALDRARRLETGLAARNWQGEMRVLSTRPAASPLVLGLILTLQAAILAA GVLL
Uniprot No.

Target Background

Function
Recombinant *Rhodobacter capsulatus* Cobalt transport protein CbiQ (cbiQ) is a component of the energy-coupling factor (ECF) transporter complex CbiMNOQ, responsible for cobalt import. Expression in *E. coli* confers cobalt uptake; it also transports nickel, albeit with significantly lower affinity.
Database Links
Protein Families
CbiQ family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is CbiQ and what role does it play in Rhodobacter capsulatus?

CbiQ is an integral membrane scaffold component of the CbiMNQO cobalt energy coupling factor (ECF) transporter in Rhodobacter capsulatus. It functions as part of a modular ECF transporter system responsible for micronutrient uptake, specifically cobalt ions, from the environment. In the CbiMNQO complex, CbiQ corresponds to the EcfT component found in group-II ECF transporters, forming a critical part of the transport machinery that couples ATP hydrolysis to substrate transport across the bacterial membrane . As a scaffold protein, CbiQ plays a central role in transmitting conformational changes from the ATP-binding components to the substrate-binding components, enabling efficient metal transport.

How is the CbiMNQO transporter system classified in the context of other bacterial transporters?

The CbiMNQO transporter belongs to the group-I ECF transporters within the larger ATP-binding cassette (ABC) transporter superfamily. Unlike group-II ECF transporters that have multiple substrate-binding components sharing a common ECF module, group-I transporters like CbiMNQO have dedicated components that work exclusively with each other. In this system:

  • CbiM and CbiN correspond to the substrate-binding component (EcfS)

  • CbiQ corresponds to the integral membrane scaffold component (EcfT)

  • CbiO corresponds to the cytoplasmic ATP binding/hydrolysis component (EcfA)

This classification is important for understanding evolutionary relationships between different transport systems and for functional studies targeting specific components.

What structural information is available for the CbiQ protein and the CbiMNQO complex?

The structure of CbiQ has been determined as part of the CbiMQO complex in its inward-open conformation. Additionally, the structure of CbiO has been resolved in its β, γ-methyleneadenosine 5′-triphosphate-bound closed conformation . These structural analyses have revealed crucial insights into:

  • The interaction interfaces between different components of the complex

  • The substrate-gating function of specific regions such as the L1 loop of CbiM

  • Conformational changes in CbiO induced by ATP binding and product release

These structural studies have enabled researchers to propose a working model for the CbiMNQO transporter, suggesting that the transport process requires rotation or toppling of both CbiQ and CbiM components, with CbiN functioning to couple conformational changes between these proteins .

What methodologies are most effective for studying recombinant CbiQ function?

Multiple complementary approaches have proven effective for studying recombinant CbiQ:

  • Reconstitution assays: Reconstitution of different CbiMNQO subunits has been instrumental in determining that the substrate-binding subunit CbiM stimulates CbiQO's basal ATPase activity .

  • Structural biology: X-ray crystallography and cryo-electron microscopy have been used to determine the structure of CbiQ within the transporter complex.

  • Functional assays: ATPase activity and transport assays with reconstituted proteins in liposomes or whole cells provide critical functional data.

  • Expression systems: Heterologous expression in photosynthetic bacteria can be achieved using vectors such as pRhon5Hi-2, which employs the nitrogen fixation promoter (P𝑛𝑖𝑓*) system for regulated expression .

What expression systems are optimal for producing recombinant CbiQ from R. capsulatus?

The optimal expression of recombinant CbiQ requires careful consideration of the expression system. Based on successful approaches with other R. capsulatus proteins, the following strategies are recommended:

Expression in R. capsulatus itself:

  • Plasmid-based systems using pRhon5Hi-2 vectors that contain the nitrogen fixation promoter (P𝑛𝑖𝑓*) can provide regulated expression .

  • Cultivation under photoheterotrophic conditions in nitrogen-limited media (using serine as nitrogen source instead of ammonium) induces the P𝑛𝑖𝑓*-dependent target gene expression .

  • Selection can be performed using kanamycin (25 μg/mL) and rifampicin (25 μg/mL) resistance markers .

Protocol for R. capsulatus transformation:

  • Transfer expression plasmids via conjugation using E. coli S17-1 as donor strain

  • Select exconjugants on PY agar containing appropriate antibiotics

  • Conduct pre-cultures in 15 mL RCV medium with 0.1% (NH₄)₂SO₄

  • For expression, inoculate cultures to an initial OD₆₆₀ of 0.05 in RCV medium with 0.1% serine as exclusive nitrogen source

  • Maintain photoheterotrophic conditions (absence of oxygen) to induce expression

How can one confirm the functional activity of recombinant CbiQ?

To verify that recombinant CbiQ is correctly folded and functional, researchers should:

  • Assess ATPase activity: Measure the ATP hydrolysis rate of reconstituted CbiQO complexes, with and without the presence of CbiM. Functional CbiQ should show enhanced ATPase activity when assembled with other components of the transporter .

  • Transport assays: Monitor cobalt ion uptake in whole cells or proteoliposomes containing the reconstituted transporter.

  • Structural validation: Use circular dichroism spectroscopy to verify secondary structure, or limited proteolysis to confirm proper folding.

  • Protein-protein interaction studies: Employ co-immunoprecipitation or pull-down assays to verify appropriate interaction with CbiM, CbiN, and CbiO components.

What is the current model for how conformational changes in CbiQ contribute to cobalt transport?

The current working model for CbiQ function in the CbiMNQO transporter suggests a sophisticated mechanism where:

  • ATP binding to CbiO induces conformational changes in this subunit

  • These conformational changes are transferred to CbiQ

  • CbiQ then transmits these changes to CbiM (with CbiN potentially coupling this transmission)

  • This coordinated series of conformational changes drives the rotation or toppling of both CbiQ and CbiM

This mechanical model explains how ATP hydrolysis energy is converted into the mechanical work required for cross-membrane substrate transport. The process involves the inward-open conformation observed in the CbiMQO complex structure, which then transitions through different states during the transport cycle .

How does CbiQ interact with other components in the CbiMNQO complex?

The interactions between CbiQ and other components of the CbiMNQO complex are critical for function:

CbiQ-CbiO interaction:

  • CbiQ interacts with the ATP-binding CbiO subunits

  • Conformational changes in CbiO upon ATP binding and hydrolysis are transmitted to CbiQ

  • This interaction forms the energy coupling mechanism of the transporter

CbiQ-CbiM/CbiN interaction:

  • CbiQ communicates with the substrate-binding components CbiM and CbiN

  • CbiN appears to function specifically in coupling conformational changes between CbiQ and CbiM

  • This interaction network enables the toppling or rotation movements required for transport

Understanding these protein-protein interactions is crucial for developing a complete model of transporter function and for designing potential inhibitors or modulators.

What insights can comparative analysis between R. capsulatus CbiQ and related proteins provide?

Comparative analysis of CbiQ with related proteins can provide valuable insights:

  • Evolutionary relationships: Comparing CbiQ across different species helps establish evolutionary conservation patterns of ECF transporters.

  • Functional motifs: Identifying conserved residues across homologs helps pinpoint critical functional domains.

  • Mechanistic insights: Differences between CbiQ (group-I ECF transporters) and EcfT components (group-II ECF transporters) illuminate how these related systems may use different mechanisms for similar transport functions .

  • Host specificity: Understanding CbiQ variants may explain differences in metal uptake efficiency across bacterial species, similar to how bacteriophage proteins show host recognition specificity in R. capsulatus .

How can the CbiMNQO system be leveraged for metabolic engineering in R. capsulatus?

The CbiMNQO cobalt transport system can be strategically utilized in metabolic engineering applications:

  • Enhanced vitamin B12 production: Since cobalt is essential for vitamin B12 biosynthesis, optimizing cobalt uptake through the CbiMNQO system could enhance cobalamin production in engineered R. capsulatus strains.

  • Integration with other metabolic pathways: Enhanced cobalt availability can support enzymes requiring cobalt as a cofactor, which could be coordinated with other engineered pathways such as terpene biosynthesis in R. capsulatus .

  • Biosensor development: The CbiMNQO system could be adapted as a biosensor for environmental cobalt detection.

  • Expression optimization strategies: The nitrogen-responsive promoter systems (P𝑛𝑖𝑓*) used successfully for other R. capsulatus proteins could be applied to regulate CbiQ expression in metabolic engineering contexts .

What mutagenesis strategies are most informative for studying CbiQ function?

Targeted mutagenesis approaches for studying CbiQ function include:

Site-directed mutagenesis strategies:

  • Conserved residue targeting based on sequence alignment with homologs

  • Interface residue modification to disrupt or enhance protein-protein interactions

  • ATP-coupling motif alteration to understand energy transduction mechanisms

  • Transmembrane domain modifications to study membrane topology importance

Expression and analysis methods:

  • Employ controlled expression using the P𝑛𝑖𝑓* promoter system for consistent protein levels

  • Combine with ATPase activity assays to correlate structural changes with functional outcomes

  • Use complementation studies in CbiQ-deficient strains to validate mutant functionality

What techniques can be used to monitor cobalt transport mediated by the CbiMNQO system?

Several complementary techniques can effectively monitor cobalt transport:

Direct transport measurement:

  • Radioisotope (⁶⁰Co) uptake assays in whole cells or proteoliposomes

  • ICP-MS (Inductively Coupled Plasma Mass Spectrometry) quantification of intracellular cobalt levels

Indirect functional measurements:

  • ATPase activity assays to correlate ATP hydrolysis with transport function

  • Growth assays under cobalt-limited conditions with different CbiQ variants

Real-time monitoring approaches:

  • Cobalt-responsive fluorescent sensors to track intracellular cobalt accumulation

  • Membrane potential measurements to detect electrogenic transport events

How does CbiQ function relate to vitamin B12 metabolism in R. capsulatus?

The CbiQ transport protein plays a critical role in vitamin B12 metabolism by facilitating cobalt uptake, which is essential for cobalamin synthesis:

  • Cobalt requirement: Cobalt is the central metal ion in coenzyme B12 (adenosylcobalamin, AdoCbl), making efficient cobalt uptake via CbiMNQO essential for B12 synthesis .

  • Cobinamide salvaging: R. capsulatus, like related species such as R. sphaeroides, can salvage cobinamide (Cbi), a B12 precursor. The CbiMNQO system's cobalt transport function is complementary to this salvaging pathway by ensuring sufficient cobalt is available .

  • Regulatory interplay: Cobalt availability, facilitated by CbiQ function, may influence regulation of the B12 biosynthetic pathway, creating a coordinated system for efficient vitamin production.

What are the major challenges in working with recombinant CbiQ and how can they be addressed?

Working with CbiQ presents several challenges common to membrane proteins, with specific solutions:

Challenge 1: Membrane protein expression and stability

  • Solution: Use specialized expression systems like R. capsulatus native expression with the P𝑛𝑖𝑓* promoter system under photoheterotrophic conditions

  • Approach: Culture in RCV medium with 0.1% serine as nitrogen source to induce expression while monitoring growth at OD₆₆₀

Challenge 2: Functional reconstitution

  • Solution: Co-express with partner proteins (CbiM, CbiN, CbiO) to enhance stability and function

  • Approach: Design expression vectors that enable controlled co-expression of multiple components

Challenge 3: Transport activity measurement

  • Solution: Combine ATPase assays with cobalt uptake studies

  • Approach: Compare activity in reconstituted systems versus whole cells to validate functional assembly

Challenge 4: Structural characterization

  • Solution: Use detergent screening and stability assays to identify optimal conditions

  • Approach: Employ techniques like thermofluor assays to identify stabilizing conditions

How can isotopic labeling approaches enhance the study of CbiQ structure and function?

Isotopic labeling offers powerful advantages for studying CbiQ:

NMR spectroscopy applications:

  • ¹⁵N/¹³C labeling of CbiQ for solution or solid-state NMR studies of dynamics

  • Selective methyl labeling of isoleucine, leucine, and valine residues for studying large complexes

  • TROSY-based techniques to examine CbiQ in the context of the full transporter

Mass spectrometry applications:

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during the transport cycle

  • Crosslinking mass spectrometry to identify interaction interfaces with CbiM, CbiN, and CbiO

  • Limited proteolysis coupled with MS to identify flexible regions

Transport studies:

  • ⁶⁰Co radiolabeling to directly track transport kinetics

  • ¹⁸O-ATP to track ATP hydrolysis coupled to transport events

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.