Recombinant Rhodobacter capsulatus Cytochrome c1 (petC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
petC; RCAP_rcc02770; Cytochrome c1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-279
Protein Length
Full Length of Mature Protein
Species
Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Target Names
petC
Target Protein Sequence
NSNVPDHAFSFEGIFGKYDQAQLRRGFQVYNEVCSACHGMKFVPIRTLADDGGPQLDPTF VREYAAGLDTIIDKDSGEERDRKETDMFPTRVGDGMGPDLSVMAKARAGFSGPAGSGMNQ LFKGMGGPEYIYNYVIGFEENPECAPEGIDGYYYNKTFQIGGVPDTCKDAAGVKITHGSW ARMPPPLVDDQVTYEDGTPATVDQMAQDVSAFLMWAAEPKLVARKQMGLVAMVMLGLLSV MLYLTNKRLWAPYKGHKA
Uniprot No.

Target Background

Function
Recombinant Rhodobacter capsulatus Cytochrome c1 (petC) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex). This complex is a crucial part of the respiratory chain, generating an electrochemical potential essential for ATP synthesis. Cytochrome c1 functions as an electron donor to cytochrome c.
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is Rhodobacter capsulatus Cytochrome c1 (petC) and what role does it play in bacterial metabolism?

    Rhodobacter capsulatus Cytochrome c1 (petC) is one of the three core catalytic subunits of the cytochrome bc1 complex (alongside cytochrome b and the iron-sulfur subunit) in this photosynthetic purple bacterium. The petC gene encodes Cytochrome c1, which contains a water-soluble domain anchored to the membrane with a transmembrane α-helix. This domain embeds heme c1, a critical cofactor for electron transfer . Within the photosynthetic apparatus, Cytochrome c1 functions as a component of the cytochrome bc1 complex (also known as Complex III), which serves as a crucial electron transfer intermediate in both photosynthetic and respiratory electron transport chains. The role of Cytochrome c1 is to accept electrons from the iron-sulfur cluster and transfer them to cytochrome c2, enabling energy conservation through the proton motive force generation .

  • What are the standard growth and cultivation conditions for Rhodobacter capsulatus strains expressing recombinant cytochrome c1?

    Rhodobacter capsulatus strains are typically grown under three distinct conditions depending on experimental requirements:

    • Photosynthetic (anaerobic) growth: Conducted at 30°C under continuous illumination in anaerobic conditions, often using anaerobic jars (e.g., GasPak™ EZ Anaerobe Container System). This condition requires functional cytochrome bc1 complex and serves as a useful phenotypic indicator of functional cytochrome c1 .

    • Semiaerobic (respiratory) growth: Performed at 30°C in the dark under semiaerobic conditions .

    • Laboratory medium composition: Most commonly, R. capsulatus is grown on mineral-peptone-yeast extract (MPYE) medium supplemented with appropriate antibiotics as needed (e.g., rifampin 50 μg/ml, kanamycin 5 μg/ml, spectinomycin 10 μg/ml, tetracycline 3 μg/ml for stock cultures or 0.5 μg/ml for plasmid maintenance under phototrophic growth conditions) .

    Cultivation typically proceeds in three stages: 2 ml, 25 ml, and finally 1 L cultures, with incubation periods generally not exceeding 3 days at each stage .

  • How can researchers isolate and purify recombinant Rhodobacter capsulatus Cytochrome c1?

    Isolation and purification of recombinant R. capsulatus Cytochrome c1 involves several key methodological steps:

    • Membrane preparation: Chromatophore membranes are initially prepared from semiaerobically grown cultures of R. capsulatus .

    • Membrane solubilization: The isolated membranes are solubilized with n-dodecyl-β-D-maltoside (DDM) to extract membrane proteins .

    • Purification options:

      • DEAE-Biogel column chromatography: Particularly effective for purifying BS complexes .

      • Affinity chromatography: For tagged versions, Strep-tag affinity chromatography is highly effective for isolating BS–B complexes .

      • His-tag purification: For His-tagged constructs, cobalt or nickel affinity chromatography followed by ion exchange chromatography (e.g., DEAE) can yield >95% pure protein .

    • Quality control: Purification can be monitored by SDS-PAGE, Western blotting (e.g., against Strep-tag using HRP-streptactin), and spectroscopic analysis to verify proper heme incorporation .

  • What expression systems are commonly used for producing recombinant Rhodobacter capsulatus Cytochrome c1?

    Two main expression systems are commonly employed for producing recombinant R. capsulatus Cytochrome c1:

    1. Homologous expression in R. capsulatus:

      • Host strain: MT-RBC1, a strain with deleted chromosomal petABC operon, is frequently used .

      • Expression vector: pMTS1 derivatives carrying the petABC operon (which includes petC) .

      • Introduction method: Plasmids are introduced to R. capsulatus via triparental crosses .

      • Advantages: Provides native cellular machinery for proper cytochrome assembly and cofactor insertion.

    2. Heterologous expression in E. coli:

      • E. coli strains: Typically HB101 or DH5α .

      • Growth conditions: Liquid or solid Luria-Bertani medium at 37°C with appropriate antibiotics .

      • Fusion tags: His-tag is commonly added to the N-terminus for purification purposes .

      • Limitations: May require co-expression of specific cytochrome c biogenesis systems to achieve proper heme attachment .

    The choice between these systems depends on research objectives, particularly whether studying assembly-related questions or simply producing protein for structural/functional analyses.

Advanced Research Questions

  • What methodologies are most effective for studying electron transfer within and between monomers in the Rhodobacter capsulatus cytochrome bc1 complex?

    Advanced methodologies for studying electron transfer in the R. capsulatus cytochrome bc1 complex include:

    • Asymmetric mutation strategies:

      • By using the fused cytochrome b system (B-B), researchers can introduce strategically positioned point mutations that selectively eliminate individual segments of the dimer in various combinations .

      • This approach has revealed that electrons move freely within and between monomers, crossing an electron-transfer bridge between two hemes in the core of dimer, forming an H-shaped electron-transfer system .

      • Key mutations used include G158W (W) and H212N (N) in cytochrome b, which can be placed in different positions within the fusion protein to test specific electron transfer pathways .

    • Kinetic spectroscopy:

      • Time-resolved spectroscopy can track electron movement through the complex by measuring the reduction and oxidation of specific cofactors.

      • Flash-induced kinetic measurements allow researchers to observe the millisecond timescale of catalytic turnover.

    • Reconstitution systems:

      • In vitro reconstitution of purified components enables controlled studies of electron transfer rates and pathways.

      • The catalytically-relevant electron transfer between two hemes bL in the cytochrome bc1 complex can be studied by isolating specific components and measuring their interactions .

    • Biophysical approaches:

      • EPR (Electron Paramagnetic Resonance) spectroscopy can be used to examine the electronic structure of the redox centers.

      • Electrochemical methods can measure the redox potentials of the various cofactors within the complex and how they change with different mutations.

    Table: Mutation patterns and their effects on fusion protein assembly

    Mutation patternAssembly with 3aa linkerAssembly with 12aa linker
    B-B++
    WB-B++
    B-B W++
    WB-B W--
    NB-B++
    B-B N+-
    NB-B N--
    WB-B N++
    NB-B W--
    W NB-B-+
    B-B N W++

    W and N refer to G158W and H212N point mutations in cytochrome b .

  • How does the interplay between redox balancing systems and cytochrome complexes affect photosynthetic efficiency in Rhodobacter capsulatus?

    The interaction between redox balancing systems and cytochrome complexes in R. capsulatus involves sophisticated regulatory mechanisms:

    • Redox homeostasis mechanisms:

      • R. capsulatus maintains redox balance through coordinate control of various oxidation-reduction balancing mechanisms during phototrophic anaerobic respiration .

      • Three major systems contribute to redox balancing: the Calvin-Benson-Bassham (CBB) pathway, the dinitrogenase system, and the dimethyl sulfoxide reductase system .

      • Each system responds to specific metabolic circumstances under phototrophic growth conditions, with reporter gene fusion studies demonstrating their differential regulation .

    • Cytochrome bc1 complex influence:

      • The cytochrome bc1 complex plays a critical role in maintaining the cellular redox balance by regulating electron flow through the electron transport chain.

      • Mutations affecting cytochrome bc1 function can disrupt this balance, forcing compensatory changes in other redox systems .

    • Growth condition adaptations:

      • Under photoheterotrophic conditions with glutamate as a nitrogen source, R. capsulatus engages the dinitrogenase system even in the absence of N2, likely as a redox-balancing mechanism .

      • CBB-deficient strains develop alternative pathways for maintaining redox balance, demonstrating the plasticity of these regulatory networks .

    • Thiol-disulfide redox systems:

      • The DsbA/DsbB and CcdA pathways affect cytochrome c biogenesis through the regulation of thiol-disulfide exchange reactions .

      • Remarkably, inactivation of either DsbA or DsbB can restore cytochrome c biogenesis in strains lacking CcdA, suggesting complex redox regulatory networks .

      • These interactions highlight the importance of proper disulfide bond formation and reduction in maintaining functional electron transport chains .

  • What are the critical factors affecting the stability and functionality of recombinant Rhodobacter capsulatus Cytochrome c1 in heterologous expression systems?

    Several critical factors influence the stability and functionality of recombinantly expressed R. capsulatus Cytochrome c1:

    • Heme attachment mechanisms:

      • Successful production of functional cytochrome c1 requires proper covalent attachment of heme to the CXXCH motif .

      • In heterologous hosts like E. coli, co-expression of appropriate cytochrome c biogenesis systems (I, II, or III) is necessary for proper heme attachment .

      • The E. coli periplasmic DsbC/DsbD thiol-reduction pathway components are utilized by recombinant periplasmic systems for proper cytochrome assembly .

    • Signal sequence processing:

      • Efficient translocation to the periplasm requires appropriate signal sequences. For example, the Bordetella pertussis cytochrome c4 signal sequence has been shown to be efficiently processed in E. coli .

      • Mass spectrometry can confirm signal sequence cleavage, with potential for multiple cleavage products at different sites .

    • Expression localization:

      • Proper subcellular localization is critical - cytochrome c1 must be expressed in the correct cellular compartment (periplasm in bacteria, corresponding to the p-side of the membrane) .

      • The bioenergetic equivalence of compartments must be considered. For example, the E. coli periplasm is bioenergetically analogous to the mitochondrial intermembrane space .

    • Protein-specific recognition:

      • Specificity of cytochrome c biogenesis systems varies. System I (CcmABCDEFGH) can mature various c-type cytochromes, while system III (CCHL) is highly specific for its cognate receptor .

      • The CXXCH motif alone is insufficient for recognition by specific maturation systems - other residues within this region are required for proper processing .

  • How can researchers effectively study the structural dynamics of Rhodobacter capsulatus cytochrome bc1 complex and its interactions with other components of the photosynthetic electron transport chain?

    Advanced approaches for studying structural dynamics and interactions include:

    • Cryo-electron microscopy:

      • Recent advances in cryo-EM have enabled structural determination of membrane protein complexes like the LH1-RC complex of R. capsulatus .

      • This technique revealed that R. capsulatus forms a compact crescent-shaped LH1-RC structure containing only 10 LH1 αβ-subunits, providing insights into its unique architecture .

    • Fusion protein engineering:

      • Strategic design of fusion proteins allows researchers to control subunit stoichiometry and orientation.

      • Different linker lengths between fused cytochromes b (3-12 amino acids) provide flexibility in studying how structural constraints affect functional dynamics .

      • The fusion approach creates unique templates for introducing mutations that break the symmetry of the dimer, allowing detailed investigation of the molecular mechanism of catalysis .

    • In vivo phenotypic analysis:

      • Photosynthetic growth phenotype testing provides a simple way to verify functionality of mutated complexes.

      • Serial dilution experiments can quantify the frequency of reversion events, giving insights into structural stability and selective pressures .

      • For example, fusion proteins with cytochrome b show a reversion frequency of 10^-3-10^-4, requiring 2-3 days longer cultivation under photosynthetic conditions .

    • Hybrid complex formation:

      • Creation of hybrid complexes combining components from different species (e.g., R. capsulatus and R. sphaeroides) allows researchers to study specific structural elements and their functional implications .

      • The successful assembly of hybrid complexes demonstrates the modular nature of these proteins and identifies domains critical for interactions .

    • Protein-protein interaction mapping:

      • Co-purification studies can identify interaction partners within the electron transport chain.

      • Cross-linking approaches, combined with mass spectrometry, can map interaction surfaces between cytochrome c1 and other components.

      • These techniques have revealed important interactions between the cytochrome bc1 complex and photosynthetic reaction centers, mediated by cytochrome c2 as an electron carrier .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.